SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|107327|e_gw1.6.64.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|107327|e_gw1.6.64.1
Domain Number 1 Region: 12-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.27e-53
Family G proteins 0.000000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|107327|e_gw1.6.64.1
Sequence length 197
Sequence
MSRNDASGFSQSYKLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDEVVA
RLDILDTAGQEEFSAMREQYMRSGEGFLLVYSVTDRSSFEEIFKFHKQILRVKDRDEFPM
ILAANKSDLDSARVVTREEGEELARSLKISYIEASAKIRSNVDQAFYELVRIIRKFQADE
RPPAKESKKKSKKCLIL
Download sequence
Identical sequences V3ZS99
jgi|Lotgi1|107327|e_gw1.6.64.1 XP_009062189.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]