SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|107793|e_gw1.7.108.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|107793|e_gw1.7.108.1
Domain Number 1 Region: 174-288
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 84-207
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000259
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 3 Region: 40-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000134
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 1-33
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000991
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|107793|e_gw1.7.108.1
Sequence length 297
Sequence
CQHKCTDKVPGFTCSCQDGFKLAADGVSCEGILKYYFCYIDECSSGIHGCEQTCKNNEGS
FNCLCQLGFRIKNDRKSCENDPSRDPCADFPPTCQYGCKLENDQPVCFCQKGYVLGADGN
TCVDINECDGNHGCSDECVNTPGSFKCTCAQYKKLENDQKTCRDRNECLTVGQCTITGSV
CVNTPGSYQCNCKDGYQLSADKSKCEDIKECDLTPKVCEQKCEETEGSYYCSCEKGFVIN
TETQKCEDIDECQIGRSDCTQKCRNTFGSFICECKTGYLINSDRKTCRGMFIYNLLF
Download sequence
Identical sequences V3Z4Q4
XP_009063911.1.39240 jgi|Lotgi1|107793|e_gw1.7.108.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]