SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|108840|e_gw1.9.400.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|108840|e_gw1.9.400.1
Domain Number 1 Region: 233-484
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-45
Family Kelch motif 0.0055
Further Details:      
 
Domain Number 2 Region: 9-110
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000144
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 751-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family Laminin-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|108840|e_gw1.9.400.1
Domain Number - Region: 114-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00711
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 144-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|108840|e_gw1.9.400.1
Sequence length 1128
Sequence
GHISDGVGNYSLSTKCSWLLDINKPNQTIWFHFIEFATECGWDHLYIHDGDSVFSPVLAA
FSGLMVKASDNQTDKGFSVKVFNRYVYVHFSSDAAYTMAGFNISFSVNDCNGGCSKQGTC
NNGKCSCNDGFTGTTCEIPICLNNCSNNGDCISGKCSCYAGFKGEDCSLHEYQSEWSMVE
STNAPVARASHASITEGDSVWIVGGHTLSGNAEKNLARYDYKKKKWTNVPEKGTIPSSRY
GHVSDIYKDVIYMYGGVSEGLVFNDLWKYDIVLSNWTQLTSSRYNISGHTAHIFDGTMFV
FFGYSPKYSYLNIVQEYDIATDIWRVSETNGGIIQGGYGHTSVIETQKARIFIYGGYHSN
PQSGYNLTDKLYMFNILTKTWTILRKSGSPMYFHSAIITNGLMLVFGGNTHNDTSVSHGA
KCYSTDFMVYNIDCNSWHVLSPPNLYKSIARYGHTMSSNNGNVYIFGGFNGMMLNDILKY
SVGKCGIVKDEETCNSIEPLTMCIWYQDKCYSRENLPDTYTPICNPAQGREVECNKIKLC
SECQSSVYECNWCSNPGSCEHSNCTIETEFSPANCSVVQDKVCDQEQNCYSCISNPLCQW
QKSFNYCINVIIIEKQEESVTPKPTAQCEKPCTNHKTCEACTEQTCMWCSNMKQCVDTDS
YVVSFPYGQCMDWTTKDAKCPGSFNSTRCSGLKSCSDCQANSVCGWCNDPNNTGLGVCME
GGAHGPVDNTSLTNHSYCPAERWYFTQCPLCQCNGHSTCIENTDVCENCQDLTEGKQCEQ
CKSGYFGNPRNGGNCSVCECNGQADTCNRESGVCHCRTRGVTGDKCELCDKNHSYVGNPK
DGGTCYYQLMTDFQFTFNLSKYEDRFFTQINFKNTPTSSDRDVDFTLNCSGYALINITTK
SESRPEEEYFTVAHECDLFRTKFEHKDYDFAGDANTTFLVYVYAYKTPFWLVVSFSQFPK
IDLVHFFVTFFSCFLSLLLIAAALWKIKHKYDSYRRRQLMIVEMQQMASRPFSNVTLDIE
RKKLIEPCSADKKEVKDPQDTFPRKRKKIGPGAIAIEPLHSNKAAVLSLIIQLPIGDEDY
VPNGQTGIAIGSTIVTIGHTRKQSVEHIKGDKSKFRKHFHHTHPETCA
Download sequence
Identical sequences V3ZKD3
jgi|Lotgi1|108840|e_gw1.9.400.1 XP_009066616.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]