SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|108863|e_gw1.9.207.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|108863|e_gw1.9.207.1
Domain Number 1 Region: 17-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family EGF-type module 0.008
Further Details:      
 
Domain Number 2 Region: 273-400
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000847
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 3 Region: 211-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000927
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 4 Region: 172-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000165
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 5-137
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 250-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000485
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 7 Region: 135-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000693
Family EGF-type module 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|108863|e_gw1.9.207.1
Sequence length 425
Sequence
YQCFCQYGYSGNNCDVFDSCIANPCFNGGRCDNNGNSFTCVCTPGFTGFTCETKVDPCSS
SPCQNGGFCQSSSTGNGFTCYCVNGFTGDTCLTSVNPCLPNPCQNNGFCQPSGTSFLCTC
QAGFSGTTCQTIASDPCSSGQCLNNGICVVTNNGLSYQCFCQFGYSGNNCEDFDSCYVTP
CYNNGVCSNNGNSITCTCPPGFTGSRCEFRVNPCLPNPCQNNGFCQPSGTSFLCTCQAGF
SGTTCQTIVDLCSPNPCQNSGFCQPSGTSFSCTCQGGYTGSTCQTIANPCLPNPCQNNGF
CQPSGTSFLCTCQAGYTGTTCQTIANPCLPNPCQNNGFCQPSGTSFLCTCQAGYTGTTCQ
TIANPCLPNPCQNSGLCQPSGTSFLCTCQGGYTGTTCQTIGNNNFTFYKTSYSLYTIICL
FYAEQ
Download sequence
Identical sequences V4B2M9
XP_009066537.1.39240 jgi|Lotgi1|108863|e_gw1.9.207.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]