SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|109065|e_gw1.9.243.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|109065|e_gw1.9.243.1
Domain Number - Region: 142-216
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0408
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number - Region: 42-116
Classification Level Classification E-value
Superfamily Prefoldin 0.0811
Family Prefoldin 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|109065|e_gw1.9.243.1
Sequence length 345
Sequence
MKIAYSISLICLHEFDFTFQYQVCRCKLDSKCEALLILSKELDQCRSERDQFKLMAEQLR
ERYQAIKRQMTGRSLVQLLCDTKEVKKSLKFEVDDLKQKLNDAQGDIKLLREQIARQRVG
STDEGMTTRHFPAYEREDLVKQLEASREQYLQLEHDLQQLLDEKEDQETELDAYKSKYEN
LNRELNYILKGDEKRIVDIDALVAENKFLNERLKQMEEEKSMAMATASKYKSILERRKNK
GILKFGQSRSGGLVITQKQVGQMLHNPTGMPSTPQAMADLQGLCGALLDTINDKNLALSH
QRKTNKLLGSRVSELEKKLKTLEVAGLWNVPGMILFICSCKSYCP
Download sequence
Identical sequences V3ZFP4
XP_009066700.1.39240 jgi|Lotgi1|109065|e_gw1.9.243.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]