SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|109954|e_gw1.11.262.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|109954|e_gw1.11.262.1
Domain Number 1 Region: 113-239
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 7-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000789
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 235-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000022
Family EGF-type module 0.009
Further Details:      
 
Domain Number 5 Region: 276-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000035
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|109954|e_gw1.11.262.1
Domain Number - Region: 50-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000542
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|109954|e_gw1.11.262.1
Sequence length 357
Sequence
GYTGRLCDEEINYCQSQPCWNNGICRSSTSGYTCECPAAFIGKQCEKDNIDNCDANSCTE
YGYCQDNIDSATCICETPSYEQPRCTRKADLCDGFCSQHGRCETFGSVRALCICEPDYTG
KKCDTEINKCMNSSCQNGATCSSTEGIQACACRDGYEGSICQHVIDECRSKPCENDGICT
GSVGKYTCKCMSGFKGFIDECESFPCQHGGTCSDRANDYSCSCKDGWEGKSCEQSVSYCN
DTVCNAGACVSLIDNYFCRCGLGVTGQNCEQSPNVCDIISPCTSTGTCMNIGGTAECQCK
EGYSGTLCESLIDPCSTLNTGYCLNGGTCKDGESEVVCQCRDPYVGDKCQARKGNFI
Download sequence
Identical sequences V4B0Z6
XP_009045410.1.39240 jgi|Lotgi1|109954|e_gw1.11.262.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]