SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|109984|e_gw1.11.686.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|109984|e_gw1.11.686.1
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000298
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 149-185
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000361
Family EGF-type module 0.018
Further Details:      
 
Domain Number 3 Region: 113-151
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000107
Family EGF-type module 0.022
Further Details:      
 
Domain Number 4 Region: 190-226
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000116
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|109984|e_gw1.11.686.1
Sequence length 245
Sequence
ECVSSPCGSNSHCKNTYGSFQCLCDVGYTQINDVYVDECLDSPCISHAACFNTVGSYECP
CDNGYKAHVIYLNVLDIDECRQNPCPSNSHCINSDGSYTCPCDTGFSDINTDECVNAETN
CPNNTDCINTVGSYSCPCQAGYSQKISGCEDNNECFNDPCSQNSICQNLPGTFQCNCYNG
FYKASSMVYIDECSSSDWNDCSEDSTCTNTIGSYNCTCNAGFIDHSPNPSRPGRICLGRS
RQNFY
Download sequence
Identical sequences V4B9I4
XP_009045538.1.39240 jgi|Lotgi1|109984|e_gw1.11.686.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]