SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|111382|e_gw1.13.366.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|111382|e_gw1.13.366.1
Domain Number 1 Region: 237-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000153
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 7-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 123-166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000035
Family EGF-type module 0.015
Further Details:      
 
Domain Number 4 Region: 157-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000991
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 44-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000285
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 84-126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000308
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 7 Region: 200-241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000453
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|111382|e_gw1.13.366.1
Sequence length 315
Sequence
MCELPVVRCSPNFCLNGGICEDTPGKPDCDCLKDFTGDRCEIQINPCDSSQPPCQNQAKC
IPSGIDYECVCPPNLNGKNCENVIDPCFPNTCLNNGVCEKNDIEAPRCSCKAPFTGLRCD
SLTDPCTGQECQNGGICTSNGASFKCTCAPGFTGLTCSVKVDLCTPQSCSNNGVCSTIDG
GIQCKCSFGFTGPTCSVQEDFCATESCLNNGGCSIVEGKVQCTCRDGFTGLKCEGVVDLC
TPESCLNNGICSTTNSQIMCKCPNGFSGLRCEVELVSHAKMAEHVFPTKCCLPVTALKNL
QERHVRQTYVKPLTV
Download sequence
Identical sequences V4AX71
jgi|Lotgi1|111382|e_gw1.13.366.1 XP_009047326.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]