SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|111743|e_gw1.14.267.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|111743|e_gw1.14.267.1
Domain Number 1 Region: 56-215
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000523
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|111743|e_gw1.14.267.1
Domain Number - Region: 2-48
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00011
Family TNF receptor-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|111743|e_gw1.14.267.1
Sequence length 237
Sequence
LCPAGGYCPAGSAIGIPCPFGKYSKSPGAKTEFDCIPCDPGFFCSGSSRDCSARYICLGG
SSTPTPTDGITGSLCPEGQYCPKGTPAPIPCPLGTWSNSTGLGIAGECQQCTGGYYCAST
GLKEPTGTCDARFYCSQGAVVSNPSDGVTGNSCTIGNYCPIGTAVPIPCADGTYMPNTGA
DECFNCTPGHYCVSQTTPEDCPPGYYCPEGTGECFLLSFFNLSLLVKNFFLNFLRMI
Download sequence
Identical sequences V4B1M9
XP_009047860.1.39240 jgi|Lotgi1|111743|e_gw1.14.267.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]