SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|111802|e_gw1.14.204.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|111802|e_gw1.14.204.1
Domain Number 1 Region: 194-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000051
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 6-17,51-178
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000288
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|111802|e_gw1.14.204.1
Domain Number - Region: 345-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00162
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|111802|e_gw1.14.204.1
Sequence length 411
Sequence
MLTDIAECQLCLPGYYCDLTALEYPRGLCDAGFYCTEGSNSSNPSLTTATGGPCPVGTYC
ETGSSQPVNCVAGTYNNLEQQQSCLDCPVGYYCEEKAISTTECAPSHGVVTPKVCPAGFY
CYNGTKTDREYPCPLGTYSNTTSLESLTECRDCPPGYYCEAENITEPTSKCFAGYYCVLA
SATPAPSLSSVGGPCPQGTYCPKGSSQTIPCPQGTYGDRPLLTALSECSVCPPGEYCAIS
GLSAPNGSCLAGYFCTNASEEANPVGKSYGDECPVGYYCPDHSYQPTACPAGTYQPFNRR
VNDSDCIPCSPGKFCNITGAGQEAGDCNEGFYCIGRASAPSPYDGITGNICPSGSYCPVA
SPQHYYCPNGTYTNHSGAAVCYDCPDGHYCVNRDRADPCLPGMFDVILGEI
Download sequence
Identical sequences V4B5F1
XP_009047861.1.39240 jgi|Lotgi1|111802|e_gw1.14.204.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]