SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|112524|e_gw1.15.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|112524|e_gw1.15.1.1
Domain Number 1 Region: 106-436
Classification Level Classification E-value
Superfamily Subtilisin-like 2.09e-94
Family Subtilases 0.000000000266
Further Details:      
 
Domain Number 2 Region: 431-575
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.17e-42
Family Proprotein convertase P-domain 0.0000929
Further Details:      
 
Domain Number 3 Region: 27-97
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 6.46e-20
Family Prohormone convertase 1 pro-domain 0.0028
Further Details:      
 
Domain Number 4 Region: 719-818
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|112524|e_gw1.15.1.1
Sequence length 915
Sequence
MNGYQNVLRVTIMGLVILEVTVANPFYTDKWAVHVEGGERVARSLADKYGFVYLDQIMPD
YYHFQHRKVAKRSIQPSNYHHKTLASDPNIKWLEQQVAKKRIKRDIHFNDPKWPIMWYLN
RGSGLDMNVSHAWRMGYTGRGVVVTILDDGIEKDHPDLAKNYDHDASYDVNGHDHDPQPR
YDYSNENRHGTRCAGEVAAQADNGVCNVGVAFNARIGGVRMLDGDVTDSVEAQSLSLNPQ
HIDIYSASWGPDDDGRTVDGPATLARKAFYDGITKGRDGKGSIFVWASGNGGRDGDNCNC
DGYTNSIYTLSISSVTENGNIPWYSEACSSTLATTYSSGSGGEKQIVTTDLRRGCTENHT
GTSASAPLAAGLIALGLEANPRLTWRDMQHIVVETAKPYRLKASDWVTNGVGKNVSHSFG
FGLMDAGSIAALARNWTTVPAQHICEIRSPDHNRIIPTNGKITVPLYTNSCQGSASHVKY
LEHVQARITMTSSRRGEIQIFLTSPAGTKSTLLAKRVRDTSREGFNNWAFMTTHNWGEFA
EGTWFLEIENGASSFRPVRLRDWVLVLYGTERHPWKKKIPARPGRAPPTRMPIIKYPSHK
PYTTRPSTTSTKNTNNWPSNRKIWPLYRKYWNPFLQNPASKSSTYARHKSHHAPHPAHMC
VYETLAKKSNISALQYIRMIRPNLTAGKNYAELKEWTLVVMGTGTHPMKDNHTPTINTGH
AFTCAGIKSNGICIECKPGYFKLGDGCVAHCPQHYFGSVEAVRLVSPNQANHSRPLVRTQ
GICAPCHSSCLTCRQARMEDCFQCSDGYERKNNLCQKKMIWDFLDPDVMKHLAWAIILCI
GAIILFSVLFGLLQARDHRKLCWSAKRFYIPDLAKGHYNGVSRTSHDDPENLSESGSSRS
SGSARTVSTDSQERV
Download sequence
Identical sequences V4A9K6
XP_009048793.1.39240 jgi|Lotgi1|112524|e_gw1.15.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]