SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|117038|e_gw1.25.238.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|117038|e_gw1.25.238.1
Domain Number 1 Region: 134-257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000732
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 32-74
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000218
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 3 Region: 70-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000377
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 4 Region: 1-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000122
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 111-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000401
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|117038|e_gw1.25.238.1
Sequence length 259
Sequence
NPCTNGGRCVDSDGTYTCECEPGFTGPQCDVDIDECESSPCVNSGTCISGKNGYTCNCSP
GYTGNRCEFDINECASLPCVHATGCKDLVNDYICYCSPGYAGKNCELEAFACASTPCKNN
AYCQDIGDSYKCHCPDGTSGKNCENDFDDCQANPCQNAGTCVDEVGGYTCICIRGYTGDQ
CESPLNQCGNNPCSNKGVCIDLLNRFRCSCPNGFAGRICEINIDECKSNPCQNGGLCVDL
IDDFLCSCPEGFSGITCNE
Download sequence
Identical sequences V4C1T4
XP_009053923.1.39240 jgi|Lotgi1|117038|e_gw1.25.238.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]