SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|118598|e_gw1.29.81.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|118598|e_gw1.29.81.1
Domain Number 1 Region: 4087-4254
Classification Level Classification E-value
Superfamily Fibronectin type III 5.3e-36
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 2367-2556
Classification Level Classification E-value
Superfamily Fibronectin type III 4.29e-34
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 3 Region: 891-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 7.66e-34
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 4 Region: 1979-2164
Classification Level Classification E-value
Superfamily Fibronectin type III 1.14e-33
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 4264-4449
Classification Level Classification E-value
Superfamily Fibronectin type III 2.19e-33
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 2555-2750
Classification Level Classification E-value
Superfamily Fibronectin type III 3.45e-32
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 7 Region: 1076-1122,1153-1288
Classification Level Classification E-value
Superfamily Fibronectin type III 3.83e-32
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 8 Region: 3900-4083
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-31
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 9 Region: 3418-3593
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-30
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 10 Region: 3754-3885
Classification Level Classification E-value
Superfamily Fibronectin type III 1.58e-28
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 11 Region: 1804-1979
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-27
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 12 Region: 2749-2932
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-26
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 13 Region: 4467-4632
Classification Level Classification E-value
Superfamily Fibronectin type III 2.62e-25
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 14 Region: 4604-4745
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-24
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 15 Region: 2170-2367
Classification Level Classification E-value
Superfamily Fibronectin type III 1.86e-23
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 16 Region: 806-826,1356-1513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.17e-21
Family Laminin G-like module 0.004
Further Details:      
 
Domain Number 17 Region: 3598-3738
Classification Level Classification E-value
Superfamily Fibronectin type III 4.07e-21
Family Fibronectin type III 0.0024
Further Details:      
 
Domain Number 18 Region: 1543-1731
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family Laminin G-like module 0.0035
Further Details:      
 
Domain Number 19 Region: 3277-3414
Classification Level Classification E-value
Superfamily Fibronectin type III 4.05e-19
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 20 Region: 1298-1363,1743-1793
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000387
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 21 Region: 15-131
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000112
Family Clostridium neurotoxins, the second last domain 0.067
Further Details:      
 
Domain Number 22 Region: 576-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000781
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 23 Region: 470-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 24 Region: 173-243
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000808
Family APC10-like 0.023
Further Details:      
 
Domain Number 25 Region: 675-725
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 26 Region: 2940-2991,3283-3307
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000653
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 27 Region: 523-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000753
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 28 Region: 623-672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 29 Region: 839-887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 30 Region: 728-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000586
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 31 Region: 404-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000698
Family Laminin-type module 0.046
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|118598|e_gw1.29.81.1
Domain Number - Region: 347-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000711
Family Laminin-type module 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|118598|e_gw1.29.81.1
Sequence length 4922
Sequence
ILEKRSADNKLIFDVRVGENGIEFLYLSSLSVRPLSVSVKDTVALKKWHHLAIQVYRTTI
SFFLNGPRVGLSSLSTTELGSVIQDSVGSYRIGQTAEGLAPFKGRLQDFQFYQELLTNRE
IAELFSGTFPEARIQTDCRCPPTHPRVKPQQTHYCIPNGVPDNSGVETLRINDEAHPLEF
ANDGDSNTVWISKFQDKVDVTVDLGDEFQVFYVVIQFYSPLPKAVTIERQINQSDVWEPW
QYYAQDCPKYFTGQVNNGETATSLSVNCLQFGTNNLQTPYSRGNITFNILSSEPVPRPGY
NDFYNTLELHEFVKASRIRVRFEDHYFVTNIRHEYFGVFEYAVSARCNCHGHSETCDMST
LPYKCNCLPASNTQGNQCEKCLPLYNNKPFRVGDQTKDYNCQLCQCYNHATSCYYNASYD
SFPTDHDRGGGGVCVDCQHNTEGQMCDVCKLTYFRPIGKSLYDADVCQNCNCNATGMVSE
TQQCEKIGGQCPCKEKVSGRDCSVCLDGFYNIQPTNPVGCEECGCNVDATINADKSCDIE
TGQCNCKRNVRNRNCDECEYGFYNLTSENEFGCQPCQCNPMGSQSIYCDPDSGQCQCKEN
IIGLKCDRCADNFYNFSLGCIPCNCNKDGIEPGSVCDHVTGQCVCKQQVGGRQCNTCKEG
AYGFGSSPNTGCEICTCNLAGIEGDEASCDFETGSCKCKERVIGRMCNRCDGNTWGLNET
NPLGCELCNCDPTGTKLGETTSPDTLACNNKNGQCSCLANRFGRQCEQCVTGYFNSETPG
GGCEPCGCQEKGTLPGTMCNTTNGQCECYRGRGLTGRTCSECENGFYGFDEKQGECSKCL
CLEAGSVNQTCQSISGQCYCKEFVTGRQCDICVQGSSKLEMSNPFGCSKSPSQQPPPTHV
ALSSTELLLEWGPPDYPNGVIYQYNVIRDVIFVHLTNLFSVSAFNDTGLLPYTSYTYQIE
AINAFGSVRSTPVIFRTLEGFPSSDAVLQVFDIKPKSASFRWTEPSEMNGPLLKYKLVSQ
TSGASDVEKVHWEGTSREVTLTSLIPFTKYNMSVEACTAGGCTKSSPILVNTPSSVPEGQ
RSPNITAINNTALFINWDYPINPNGIIIFYELWMQGMPGPNGIRNPESKRVFVSSGQYNP
RVVDTPEENALPPPDTNYTVTDLEPFTEYEFQVLAQNDAGKAASPWTVGRTGEALPNAMG
APVVEGLSSSQLKVSWTEPPPKDARGVILIYHVYHFVKTDLTQDQFAPPFQWKLVSTSNG
SVYSTLIDGLTPYSQHNFKIGACNSVGCVNSTSASGRLLPAAPEGVVKPTADGYNSTVMS
IRWPEPTFPNGPSPNYVVEKTSIALSYPPQVDKGTRFPGGGYYIFPSSVLPQSVSFTGIR
LSFRLKSQSGLLLFAATETQEEFIAIQFDEGRPKFLFDTQGNIGYITTTNDEGLRYTNGD
WYYMTIRRSGIHGTMLIDANLIRDTGCQSTSVIGQTTAIYVGGLPPDFVIKRNDRRASIQ
RTGFQGCLSGIEILQQESPFEVWKKLDWKSAEANELAFLNWEGCPVNLDKGLHFLGQGKH
HRKMIGGDEVEVQFQFRTALHTGLLFFTYGGTGIYMYAGLIQGDLYFEFSNGVKRGSVTY
TDPDINFCDGNWRQVYFRKTGFLANITIENGATTLSGDAETSFDVPTASSVYVGGIPQQS
EAKQFMAKSLKFDKFSGFGGCIAFFLVNTKLFEFYKEAVEVVNVNMDGCAPFFLPNDTCK
DNLITQVYEGVERETFDIGLQPYTDYIYRVTATNEVGSGSSAWGYGRTKEGAPVGVNEPY
EAKALSGYTIQAEWNRPDSTSGLLTKFILIGYVSQNDSIEPITQEFTDTKIRTGNLTNCV
PYTDYLVKIIACTAGGCTESEEGVLVRTLAEAPEQVPAPTADVQTTSMIVKWEEPGRPNG
LISGYYLFQDDVKVYEGGENFFELKNLQVYTSYRFFVRACTSAGCTSGPTVTLTTAQLPP
TSVLPPVLQVLGTNRIDVRWKTPDQANGALERYVLLVSTIAGQDGTDLYNSTELFLSTVL
TNLTAGTQYFIRLSACTGGGCTTSDVVNATTEESAPDGIPDPVVTSPSWAELEVSWGIPA
LPNGIILRYELYHNKKIVHSSLVREYRIDNLQPYSLHEFRVAACTIKGCGFSNEVQARTM
EAPPEGLIVLEVVGINSRAVNTSWSAPAKTNGRLFYDVYFEGLYYKDPEKMDYRTDTLRK
SLLQVEEAYKWFNISNLIPLSQYSIQVNASNTKGFILSNVVLFTLPPGTPDGVSPPQLVS
ETPNSIKAQWPPVGRVNADEEPSYILQFREDRQDAMIQDIFGPTSTLLFTKENLLAFTTY
QFRVKASNTRGSTISEWASQVTKQDRPVGVNPPQIVNINMRYIDLKWSQPFSPNGIIMHF
NIYQNSQLRAKVEANVTSERIDNLLPYSYYIFKIEACTLGGCTKSDESLRVRTLQAAPEF
DEGPTVISLTPASVEIKWKEPIRPNGVITSYSVERRVNGSEAGTVLISTPATVLSYIDED
PFLSPFTSYDYRVAAENFAGAGYSPWTTVVTKPSRPSGVMAPEVQVINSTAITVKWTTPI
KDNGLLEFYIIRLPEPRVEIRNTSQLETVISGLTPFTDYSVTLTACTSGGCSESVAVPVK
TLAAIPGGIAAPNPIAVSQLIISITWQPPSQPNGQIIAYELSRQKIAQPLDPTVTDIGEW
SRVYSGKGLFYEDRGLTMFTTYIYRVTVFNGIGQITSDSSKNVTTFGGLPRRPAVVAATP
TSHLTIKVDWQTPDPVDLQGEVEKIGIVARSTSGNVTAEPPPDANSYILENLSPDTEYSI
TVKLTIYGGESITSNPVTARTMNGAPEGIEPPVLTVLSDTSLRVSWSQPSQSNGQIVNYN
IYINNDIRSTNMSTPGSIILNDLQPFTVYRIKVEACTQFKCASSDPTLGTTSESLPQGLA
NPTLEALSPTSVRINWAKPQQENGIIRNYELSRKTLKKCSEISEPQVNPELTKCTYIECS
ILESRCGNKCYTGQKRCCNGVIHDAIFGYECCESQYVPKPSVDAVCCGGKFYNPLPNYKC
CGKRYILVEAGTICCGDSLEDRVTIGYGDSCCGSVPYSTTGSQICCTGTLYGGYNKQCCG
GQVVSQSAICCGNDTSGDVYLPQSQKTCCGRKYVDQQTTLCCTSDTEHTKVRTNMVNLKT
TANEKCCGMERIGQSLSCCNYVGYNPATQVCSDKSSTLQGCGTGTVCPISQTSTAVCNRC
DFNSATQLCGAVTGFYTNQPPTIPSTDDMCIVDISTVFTGLQLTYTDTDLTAFTRYEYSV
TVSNNAGSISSEYVGIKTLPAPPENVKPPNTRVNPEQLYAVYLTWETPGKPNGEITQYLL
RRNNVELYRGTRLMYTDDNNILPYQTYTYKLTVCNIAGCTDSNSVQVATAESAPEGLSAP
VPQPVNSTAIRITWSPPTKPNGLLLGYTVIIYGKRSTFGADVQEYLVTGLVPYKEYQVSL
EACTVAGCTKTDDVTAKTLEALPQGLAAPKTIIIDSTAVEVYWTKPQAENGLIIKYILIR
RKDGIESVAYRGTELVTQDLALLPETTYEYAVEAENSAGKIRSGFTSVITPKRTPAYVPP
PKNVTAVSSTAVFIDWDPVAVSGVVDQYRVLLTEGATVAIDRSIGLDTSTTISGLKPYTE
YNVRLQVCLMGVINGCGTGQGVKVRTFEAPPLGMAAPALEAKASDSILVSWKVPEQPNGV
IKRYLVYKRKFGETSDIIVNESPGIDLSFTHAGRDLLPFTTYEYRIVAYNGVGDVSSDWS
RVRTLEAVPEGFSTPTIDSSDAHGFRISWNPPTKPNGIITMYNVYYKEINSDPTIQSPYM
MVSVNTTSTSVSGLKPYSEYDVRVEAVNSAGGVSSINVRVQTMQSSPAGLLDFSIEKIDS
GQALILRWNPPLKPNGVISNYKIYEDGVINPVYQGLNREFEFRRLEPYTEYTVSLEACTS
TGCTKGKQQTFRTAETLPSIQPSPTTGLVNATHVLLKWVPPVNPNGKILSYEVLRRQSVT
RRKRDISDPQIVYKTLDTSKPEYEFMDSGLKPNSNYEYQVRATNAKGSTTSPWISVSTGE
AAPDGVQPPRVSHIGQSVNMLLVEWDEPAQPNGVIQRYQIKRNSSIPFSFGASDARSFTD
SGLEPFTWYEYTLTACSGGGCTPSDPTFIRTKESAPLKVSPPDVTAVNSTAVKVTWTKPQ
VTNGAITLYVLYMDGSKIYEGLNLEHTVSGLLPYNLYRFYLQACTNGGCASSTETSGRPD
DSKPEDMRTPTLRVMSSTSIEVSWRPPQRSNGIISSYDVRRGDQLIYTESLSSSGTLKTS
HTDYSLLPGEEYTYTVIARNRKGSAVSPPATARTYASSPSGLDPPSLVALSSTSVQATWK
SPIRPNGVLVNYTLFQGNDRVYSGPPNKLSYIVPGLQYWTEHTFRIQACTVRGCELSEDA
TVRTLEAIPEEQGKPSLLPLADENGASDGVFITWDPPLKPNGVIKRYDVKRRLVVRDSTG
VIYGDELLVYNGTANQHTDRSPSLLPFTEYQYLVSSFNSIGRATSLWESVTTKEAPPTFV
PTPTVTGTTSTTIDVTIMAPAQPNGIIRLYNIVANGTVVSIGSVLPLSPFTTYSLKVRAC
TGGGCTDSSPVTAKTGTAKPSGLEPLVATSLNSTSVKLTWSQPLQPNGQIIRYLVFERTA
CPLTAQPYEESCVPGDSRKVYEGQELVTTVASLEPYTAYEYQLQAENQAGGVDFPTWVRV
ETAASDPKYMKIPVLTQNDTKAVIDWTESFILNSKLREYILSVDGVVKFRGITTVYGEER
RTKTQGIFFIQAVTEVGEAETPSVIFDPGAADNLGTTTVPPAVTEKQSDEIPFYQEIWFI
VLVCILSLLLLFILIVLCVRYCGKDRPYVRERRPLYNRQPKSPAPLTYMIDPNGSVYETV
SF
Download sequence
Identical sequences V4AG81
XP_009055023.1.39240 jgi|Lotgi1|118598|e_gw1.29.81.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]