SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|118711|e_gw1.29.401.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|118711|e_gw1.29.401.1
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.13e-34
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 103-294
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 723-897
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.29e-31
Family Laminin G-like module 0.0045
Further Details:      
 
Domain Number 4 Region: 915-1093
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.36e-18
Family Laminin G-like module 0.008
Further Details:      
 
Domain Number 5 Region: 297-468
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.67e-18
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 6 Region: 466-502
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000479
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|118711|e_gw1.29.401.1
Sequence length 1210
Sequence
AWTASTQNSAQYLAVDLGQRYIITSVATQGRRGSDEFVTEYFLEFSDDRETWRIYTNEYG
IPEMFDGNTNGYQEVKNTLRYPITARYVRFNPQRWNMFISMRIEVFGCVFVPYVTSFGGS
GYIQYDLSQQAVQTEEDKLELRFKTNKPDGIIFYASGNQGDFVLLEMRRGFLYFRLDLGS
TQFTRGRTEVIGGSLLDDHNWHDVVIRRQKHELLVVVDRLENKVKTEGLFYRLDLDKFVY
IGGVPYFNQDGIEVKYNFVGCVENVDFNGAKLLVDAKAGESTMIRKVGPVSFSCGLRSDP
PLSFPTSTSHLLVKGDGTGPVRVQFEFRTHDENGLLLYHPLFQFSFNNSIIFNFLTSLIT
VCSSLETSLVVSNSTRSFTDGLWHTFSIYVDDKMVNCTVDRNVKISNRRLEISAGTDFYI
GGFEIVTMGFRGCMRKIEVQTKQIDPDDPQIVTNVDADIGSCGIRDRCTPNPCEHGGRCH
QDWNSFYCNCDGTGYKGQLCHISAYQVSCAMHKLYSNVEGVEDAMIDPDGSGPLKPFPVQ
CDTVSERITKTKISHDSMSRITVNGYDEPGSYVRLINYVTDLPELTEIIERAQSCRQFIQ
YFCNNSRLLAPINSVNNQNSNLPRTYGWWVGRTFQPMYYWGGAAPGSGKCQCGLEEKGCE
GGSTTCDCDAMLPVEKNDGGYLVHKEYLPVIELHFGDTGTVTDNKLGAHLLKELECEGDD
LFDNVVTFRKADATIEFATFEAENAGDIWFQFRTTTTDGVMIHNTGPVDFIEVRLFQMDT
IQFRYNVGNGVVVLSFKSPGPLNDDNWHTVHVEHNRKQAWMRIDDQPDVFVSEDSDLIRM
LDLTGQLVIGAAVDYNDGYVGCMRGLRVNGQLLDMRGMVERGEVTYGVSVGCVGKCSSSP
CFNGGTCREGYSGYTCDCSYTPFRGWMCGREVGVNLQKNYQVKYEFDAIQGLSASDFQFA
RVGFSTKEKQGILLQIRNEANTEYITVEVNNNGGVRVALDVGFQREEVNTPNQGIDYTNG
QQHEVVVQRSNKGRTIKVQVDNYAPSIKTFDVADNGDTILDNPKYLFIGSNNTADTSRGF
EGCIFRVQVDNIFPLKRAFQDPKPDFITLNPPVKEDMCGFEEITQPGDILESRPKGVPDF
HMIKLFFSAILAIVFLCSIIFLVFLFRRRDKGDYDTQEAKGADVADNQDAAVMYNETGIG
EIAKRQEWFM
Download sequence
Identical sequences V4ABV6
jgi|Lotgi1|118711|e_gw1.29.401.1 XP_009055143.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]