SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|119346|e_gw1.31.158.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|119346|e_gw1.31.158.1
Domain Number 1 Region: 40-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000054
Family EGF-type module 0.005
Further Details:      
 
Domain Number 2 Region: 386-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000367
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 3 Region: 348-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000502
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 232-275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000551
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 5 Region: 424-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000159
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 6 Region: 462-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000218
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 7 Region: 310-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000108
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 5-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 9 Region: 195-236
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000042
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 10 Region: 156-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 11 Region: 117-156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000007
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 12 Region: 269-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000197
Family EGF-type module 0.012
Further Details:      
 
Domain Number 13 Region: 497-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000034
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|119346|e_gw1.31.158.1
Sequence length 542
Sequence
TELDQCENNVCKNGATCINKFRYYTCSCAKGFTGDTCNSNIDDCFSQPCLNNATCQDGIN
SFQCTCQSGYTGKNCETEIDLCTHDYCEHGVCVQKHGVLSCQCFNGYQGDRCTSEINECV
ENNVLCLHGGICKDLLDDYICDCSDTGFTGTHCEKNIDDCCDCSCLNGGTCNDFINGFDC
TCAEGFTGTRCETMVSYCYSSPCEHNSICTDKPNGFTCTCKPGYEGILCQNEIDECENQP
CLNQATCSDNINYYNCSCPSGFTGKNCDVNIDDCLQSRCNIAGTDYCVDGINNYQCVCLP
YWTGDLCENKIDQCVTEPCYNNATCTSIDNAYRCTCLPDYTGSTCSVQIDDCLDKPCLHN
GICFDDINNYTCNCADGFKGRNCEININECDPNPCKNDAKCSDLINGFTCRCEAGWNGTL
CDINIDDCTSQPCFNNATCDDLINDFSCNCTEGYDGKTCDNNIDDCYLQPCKNGGSCTDL
IGNYSCQCLEEYEGHQCEFNIDDCIYNNTCLNNATCKDGWRDITCQCTPYYTGDDCGKGT
DT
Download sequence
Identical sequences V4AIT3
XP_009056079.1.39240 jgi|Lotgi1|119346|e_gw1.31.158.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]