SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|120635|e_gw1.34.135.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|120635|e_gw1.34.135.1
Domain Number 1 Region: 8-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.96e-31
Family Laminin G-like module 0.0017
Further Details:      
 
Domain Number 2 Region: 190-373
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.07e-31
Family Laminin G-like module 0.0027
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|120635|e_gw1.34.135.1
Domain Number - Region: 378-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0605
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|120635|e_gw1.34.135.1
Sequence length 2131
Sequence
MCLLFLFSASFYGQSYVRVPFQLSARSNQVDLDFKTPRPHGLLLLAAGSTDYFSIELSSG
IIKVQIDLGSGEAILNSPPGLRLDDSQWHHLSINRTNGNLVLTIDEVITSSTVIPGKFSE
LNIQHGIFLGGLGTFTDAYDGTFKYFRGCLKKTFFNKYDILSTAQQMNNPVNTFEISWSC
DDEFDAGSDQAITFKSDSSFVAFPPLHIREKGTFSCDLKTRSNTSVIFFNTGRRSSGLDY
IGLELIRGKLKLSANKGSGVIDVFSDKKINNGHWHQVDVIISPGMLELRVDGQRNITRLY
SKDNKYLNLAGHLYVGGIGVKDKSNAIRRGLESLKHDRGMHSSMKGCIRNVVINSRTYGF
REVVVSRVVQPKCSFDFPCATEPCIEGSVCKELDNNEYKCLCNQNVCTKYVADVLAIDEL
RVEEGGEATLTTNVIDVIFDYQAYSIRESSVQFTVKVHPRFGSLEVNLRRRTNEDIFTLL
DLVGGKVSYAHDGTDTRSDDVTIEMKITSYDANFPKQYQGSFMFVLPIRISPVNDPPKLV
LVAGSTIQILKHTKTLFSNQIFNVDDPDSTPNKLRYMLTYINNDHGYFIRANVSKKEVTD
FTQAEINSGIIWYMHRKDNTVPIRLKVSDGSLETAEAEVMLHAVDIDISIPINSGLKMAL
GTSAFILPGNLTAAANVQGQTIDLRYRIIQKPKYGSIQRKQHENHKWVTVETFSQRHINK
HKIRYINTKKPESEYFDEFRFLVSAKESTTIENKFRITFQSVKLQLNNNKQILLASTGIG
QVTSKDLEVISNSVAVESDQIIYTVAGTQSQGQIYRVPEDDATSKDSLFRDVPPISTFTQ
KDINNGFIYFKLTKPTFTPVNNFVKLSASFQDQQVLEMRLNWKYEPEESSIRFTNNGLQG
VIEGGSKAILRDDLYLEIDGIQETKFSILSLPQFGMLILKDPRSNAVIQSNISEFTSKDI
SESKVYYKHDDSEHDKDSFSFMSIPLYIDEEEISGEIQEISGVFDIKMMMRNDNQPVREV
DRVFHVVTNKNRPLTIKDVSFSDPDIDYDASNLKYTRRGIPNGDIVDRESGAPVYQFTQQ
DLIDKKLLFQHSGAEYGRAALWVTDGQFFTNSLFEIQASPPFVKIQNNTGITVKKGSFSS
ISSHNLSLETNIFLEPSDINVVLIEEPLYGHLRIRGKKVSEFTYDDLLSSNVKFWHDGSA
NQEDKFKYAIVANEAKVQGIFPIVTYLESQLQPPRITHNKILEVSEGSGAIITQNQLNVH
HPDSIPTDIVYTVTTKPQYGAIYVKGILSDSDQTTFTQQDIIDDYVKYTNTRTGVLTDKM
VFDVSNQFQTLRNLEFFIEIVPNILVFETEEVKVKEGGRQALQPNHFKLKGRFYQGKEVV
YEIKQQPVKNEIYYEHDGSERLKDEFTVVASLSDKSKASLPHVVTVTVESVNDQAPRIIV
NSVLEVWKGSVTLLTNQSLLAEDPDSFDDDIIFRVSSPTNGHIAYLDNTFREISQFTQSE
VDKGLIVFVHEGDNLGEFNIQATDGVNNDQLQIFHIKAKPLVLTLVENNPLQVFPATLQP
ITRDVLYTTTNAKNVTKPITYTLETRPRRGKIVVLDNGVPLEVTSFTQNDVDDAKIFFKH
SGNIHHWSESDSFFFEISTTYAEPLKEELIDIQISYGNINSGNIDQFLRRSPPSVREGSE
ITIRPEHLDISLLERRLYQFGSRVSVDFMLIGQPKYGYLEKSRRRLATTDIFTQKDINQG
AIRYFHDDTDTLEDVFDIAVQIRPPDLSTTDSGIDSYDYETNFTITVTPVNDQNFKLVTT
TPSVQVIQGQSVNITSDHLMTSDPDTSPSGLVYEIRTAPKYGRLVLDKDTGKSVTSFTQK
DVDSDLVAFISDGTQEADSFFFRVSDGVHNHYYKKFNIYILPITVKVNSKESIYLVQSES
SVYISPKSLNVSTNGERSKVWYNVTKEPEYGSIYYQESQTKYFSQSDIDESLMLYIQSDL
SVGEDYFICDVYVEGVNVFLSKQRYDIRVKPLLKQGPLHAPAGSNVAITKYTLDASRLAA
VTGDNPVFDITKQPEFGRIVKLSRTKKDLYSVAPIYKPVDFFTHEDVVYTKVYYKADDSA
VDSAASDKFSFTLRAKNVQPASGNFIIDLQP
Download sequence
Identical sequences V4BU42
jgi|Lotgi1|120635|e_gw1.34.135.1 XP_009056672.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]