SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|122440|e_gw1.40.90.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|122440|e_gw1.40.90.1
Domain Number 1 Region: 86-194
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000314
Family Pentapeptide repeats 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|122440|e_gw1.40.90.1
Domain Number - Region: 11-124
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00188
Family Pentapeptide repeats 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|122440|e_gw1.40.90.1
Sequence length 228
Sequence
MSSLSLFRSSNISLLLFRPSNISLSLFRPSNISLLLFRPSNISLLLFRPLNISLLLFRPS
NISLSLFRPSNISLLLFRPSNISLSLFRPSNISLSLFRSSNITLSLFRSSNISLSLFRSS
NISLSLFRPSNISLSLFRPSNISLLLFRPSNISLSLFRPLNISLSLFRPSNISLSLFRPS
NISLSLFRLSNISQIYHHFHYLDLQTYHFYYSDLQICTRLTGSGKVPD
Download sequence
Identical sequences V4A7S2
jgi|Lotgi1|122440|e_gw1.40.90.1 XP_009058347.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]