SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|123205|e_gw1.43.226.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|123205|e_gw1.43.226.1
Domain Number 1 Region: 78-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000758
Family EGF-type module 0.023
Further Details:      
 
Domain Number 2 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000224
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 40-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000343
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 4 Region: 2-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|123205|e_gw1.43.226.1
Sequence length 166
Sequence
DACTNDPCYNAGTCQLDHSLGFRCLCPLGKTGTLCECGNNPCKSMPCHNGATCIMLDTVN
YQCLCQDGYRGLNCEELTDPCASQPCQYGGTCDRFLEEDTFYCTCPDGRMGLRCEKEYDG
APCNVNPCQNGGVCQPMLNHADCKCPSNFMGEKCNKSKCLVKIINV
Download sequence
Identical sequences V4A1E0
XP_009058791.1.39240 jgi|Lotgi1|123205|e_gw1.43.226.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]