SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|125008|e_gw1.48.143.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|125008|e_gw1.48.143.1
Domain Number - Region: 92-182
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000125
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|125008|e_gw1.48.143.1
Sequence length 186
Sequence
GSDDPESVKQEEDFPSFAEWTQKVLAEQEKTKQESKTTTGKASQPSTNQKKLRNNYASKA
CGAKVLAANPESENINHVLTANKDEYMINPCSSKKWFVLELCEPVQVKLLELASLELFSS
QPKSFRVSISDRYPAKEWIPLGLYEASDERSVQSFQALNDQFVKYVKVELIEHYGNEHFC
PVTLFR
Download sequence
Identical sequences V3ZYW3
XP_009059640.1.39240 jgi|Lotgi1|125008|e_gw1.48.143.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]