SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|125410|e_gw1.50.96.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|125410|e_gw1.50.96.1
Domain Number 1 Region: 1142-1194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000795
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 2 Region: 737-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family Laminin-type module 0.009
Further Details:      
 
Domain Number 3 Region: 336-379
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 393-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000255
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 5 Region: 1199-1249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 6 Region: 4-46
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000573
Family I set domains 0.053
Further Details:      
 
Domain Number 7 Region: 796-844
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 8 Region: 450-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000809
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 849-903
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|125410|e_gw1.50.96.1
Domain Number - Region: 301-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 1105-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00209
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|125410|e_gw1.50.96.1
Sequence length 1276
Sequence
WGHIPSGDRVTSTSIDGRGSLTITGVVPDDSGAYTCEAINNKGSIFAVPDAIIIVRRQSG
ICKPPRYNSDAKSEAECIRCFCFGQTEQCFSSGLYNTKVISCISSRSIFRAKYIATCFAI
AKGDLFPVEEGFITFIPSTREFSVQDFQQVLRGDSYYWKLPKQYLGNRITSYGGDLTYRV
YYDVQGFRSGDLTSDPDVIISGNGITLYHRSRQQARPDSQFTVDIPLTESSWDRSETSRR
GDTLISEYASREDLMMVLENVTSILIRATYDTRQTSTRISNVLLSSTTQQERGFGKAVRV
EDCSCPTGYTGLSCEQCAAGFYRVNRGRYLGECVPCNCNGHSNDCDPLSGVCRNCRDYTT
GPYCDLCLEGYAGNPRRGTPNDCQACPCPLTVKSNQFSSTCVLDNDGLITCTNCPDGYEG
RQCERCAEGFEGNPRVVGDRCVQVDVTERCDPRGSLSPTPNPLTGTCTCRANVQGQLCDQ
CKAQSYYLSSDYPYGCLACFCMGVTEFCTSTLQNRAQIGVSFNNDRMGVTLSDMLQRTTI
RDGFTINSNDRELVYRGFQNQPKEIYYWSLPSRFLGDKVSAYGGYLRFTLRYRPGIDNSP
ISIEQPIVEIKGNDIDLIYKTDRQVPANSQEPFQISLFEQNWFRMDGQPATREFLLMALA
DLDAILIRASYTEETDEVALSDVTLDVAENRQTGQDRAWAVEECACPRGYKGLSCEDCDT
GYTRTGSGLYLGLCGRCQCNGHSNECDPESGVCRNCQHNTEGDSCERCQAGYYGDASRGT
INDCQKCPCPLTEYPNQFSPTCILDTDGQVTCTACPPGHTGRRCESCVQGFEGNPLQPGD
SCRKSTIQCDCDPRGTIPNAQCDANTRQCLCRTNVQGLRCGSCKAGHFFLDRSNKEGCLA
CNCMGITNQCTSSSYYRDVITPTFPNDGSHNFGLTNRRLSRMIKDGFTVDGSRNQITFNN
FASVQRERESLFIQVPPRFRGDKVTSYGGRLKFTLEYNTAADSGQKYMDVDLEIISNNQR
IYLLLNPSPNPQETNTYDILLREESFRMLDGSTPSRGSFLAMLAKIDGMLIRATHHSMMD
SITLRDLSMEIAVPGPNGRRRAPEVESCTCPEGYTGLSCQECAAGYLRVQDSGSAIGRCV
RCNCNGHATSCDPNSGKCLNCRDNTEGDRCERCIDGYYGDPTAGTPNDCRRCACPLTVDS
NQFSPTCRLDPGFEVICDRCRVGYTGRDCGECAPGYVGNPREVGGSCQREEGKLFSFEGH
WFHRADNIFYNWIFLS
Download sequence
Identical sequences V3ZCR3
XP_009060525.1.39240 jgi|Lotgi1|125410|e_gw1.50.96.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]