SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|127661|e_gw1.58.115.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|127661|e_gw1.58.115.1
Domain Number 1 Region: 100-229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|127661|e_gw1.58.115.1
Sequence length 244
Sequence
PCNTNCNGGCIQNNGNCEACNDGYWGIKCQSQCPTNCRLSKCDKNNGYCSECKNYNWGDK
CEELCSVNCKYHSSITCYKTSGKCNSGCKDTWYGDTCNNKCSSKCKQSKCYQDTGRCTSC
KAGYYGNQCTEHKTIIHCNTGWYGNQCQTKCNSNCINGCDQTTGRCTSCNTGWYGNQCQT
NCNTGWYGNQCQTKCNSNCINRCDQDTGDCLDGCIDGKSGRQCTEATGNSYNFIYFWVKS
TIFY
Download sequence
Identical sequences V3ZT67
XP_009061746.1.39240 jgi|Lotgi1|127661|e_gw1.58.115.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]