SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|127728|e_gw1.58.198.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|127728|e_gw1.58.198.1
Domain Number - Region: 32-136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0123
Family Growth factor receptor domain 0.0021
Further Details:      
 
Domain Number - Region: 127-238
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0146
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|127728|e_gw1.58.198.1
Sequence length 256
Sequence
SGRCRQSDGYCTSGCDEGYWGPAGLCDQTCSNCNPGGCVMNSGLCIAIGCRTGWYGTTCN
CGKCNEGYFGDNCNQNCSINCNGGCKKSSGSCFECNAGYYGDYCKQQCNDKCINNECLRN
GQCRFGCMNGKTGSQCDGNCSSNCTICLQTDGNICKECKPGLYGISCDKLCNNTCKKVNS
KPTCNITTGECTTGCAKGFHGKYCSQNCSRNCYNQLCNQTTGFCKDGCVDGKHGNNCSLG
MSFEFFVFFYHDLQGQ
Download sequence
Identical sequences V4BF84
jgi|Lotgi1|127728|e_gw1.58.198.1 XP_009061748.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]