SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|128482|e_gw1.61.125.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|128482|e_gw1.61.125.1
Domain Number 1 Region: 103-223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000816
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 76-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 3 Region: 230-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 1-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 37-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|128482|e_gw1.61.125.1
Sequence length 279
Sequence
DFCVDNNCMNSAVCVSGDGNYTCNCTEGWEGWLCNEDKDDCLSMPCKNDGVCSDNGTNSF
VCNCTIGWMGDTCSEDVNECAENPCINGKCLQDVGTGNFSCACPVDYQGLLCDQMINDCE
SDPCKNGGNCTDGVGNYICSCPSGLQGKNCDQDVLECSESPCQNGGYCQESFGSYKCHCG
ETWSGDNCTEDFDECKVECQGQGFNCTNTNGSYLCECSHGYRKMNDMLTNYCNSEPCKNG
AKCENVWGDAKYACKCNYGWTGVNCQDEDDEAHSKNRFL
Download sequence
Identical sequences V4BDL5
XP_009062505.1.39240 jgi|Lotgi1|128482|e_gw1.61.125.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]