SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|128699|e_gw1.62.198.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|128699|e_gw1.62.198.1
Domain Number 1 Region: 27-131
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000085
Family Spermadhesin, CUB domain 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|128699|e_gw1.62.198.1
Domain Number - Region: 160-197
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000104
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|128699|e_gw1.62.198.1
Sequence length 217
Sequence
MKSALLLLKIIFVLLIISDYGSALYTNCGGLLEAEKGNIQTPNFPSPFPTPINCAWVIHN
PHPEKKIILYFTQYFLKNSFHLSEYDEYISEHDNKGIKYLGEMNYINQFSSMAAYKPYLV
IRFKVRDMGNMHLRVEEFLKDVYGFNITYEVVNKEQNIKEACSAHNCSFLGHCVANSIFS
DYKCQCFPTFFGDYCQYGPFCDPSNGKNMCQNDGQCR
Download sequence
Identical sequences V3ZVN9
jgi|Lotgi1|128699|e_gw1.62.198.1 XP_009062650.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]