SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|131001|e_gw1.72.64.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|131001|e_gw1.72.64.1
Domain Number - Region: 403-450
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000205
Family Laminin-type module 0.026
Further Details:      
 
Domain Number - Region: 96-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0255
Family Laminin-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|131001|e_gw1.72.64.1
Sequence length 648
Sequence
CPQGKWGENCNNVCDCNGQGVCDIITGYCVCSPGHTGEKCQTVCPAGTYGRNCQYHCGCQ
NDAACDPVNGACHCKNGFTGALCELSCPPGTHGSGCSQVCQCQNNATCDSETGQCACKAG
WMGKFCNLPCDKGYFGLNCATKCPCSRNIVSCDRYNGQCHCSTGFMGSSCDVQCSQGRYG
GNCTEYCDCNGANCSPVNGACLCPLGYTGNKCQVRKCPRNLFGSKCQYVCDCNWNTTDSC
HATNGECHCMPGWTGVNCQNQCLLPYYGPRCSKTCNCAGAVCDHVTGACRCTAGRTGVTC
ADTCPSGSYGIQCKQRCECRNDGVCNPVNGACTCEPGWQGIFCDQHCPANRYGKGCRGNC
TCANNAECHPKDGFCICPRGFQGTNCEQKCSNNTFGFGCRQRCNCNVDNTDKCDHITGQC
HCKNGIQGATCDSGCADGYWGEDCLSTCQCNNRGTCDSTGVCECQAGWTHSDCSMPCPKG
TFGIKCSQKCQCKKATSCSAVSGQCICEPGYRGIYCDEGMLCPLGTYGKDCKNTCPRCDR
GSCDHETGKCICYPGHTGQLCHIQCQAGTYGKDCSFRCDCQNNGQCRPTDGICECPSGYN
GVQCERRCYAGYYGKNCASKCQCKTSEYCDVISGCLGMLNIWSYQFVV
Download sequence
Identical sequences V3Z3A3
jgi|Lotgi1|131001|e_gw1.72.64.1 XP_009064239.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]