SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|132184|e_gw1.78.56.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|132184|e_gw1.78.56.1
Domain Number 1 Region: 12-225
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.49e-52
Family Nuclear receptor ligand-binding domain 0.00000423
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|132184|e_gw1.78.56.1
Sequence length 226
Sequence
NRVLSTLLTLESQLDKLYASPDPNAPESEVKFKAAVSDLADRELVITISWAKQVPGFTSL
NLSDQMNLLQHSWLEVLCLNLVYRSCPYSGYLCFAEDLKVGSDLVKTYNVPPEFDNLTRK
LCKKFTLLGVSKEEYVLLKAITLCNIDVVAEVTDTVRCLQDKLQDSLMETIRQRHGGDMK
RLGQLFLLLPPITHIKLLAKQFWFDMKKEGRVLMHKLFLEMLEADS
Download sequence
Identical sequences V3ZJR9
XP_009064848.1.39240 jgi|Lotgi1|132184|e_gw1.78.56.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]