SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|132384|e_gw1.79.47.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|132384|e_gw1.79.47.1
Domain Number 1 Region: 87-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 170-214
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 53-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 13-49
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000903
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 5 Region: 129-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|132384|e_gw1.79.47.1
Domain Number - Region: 212-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.034
Family LDL receptor-like module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|132384|e_gw1.79.47.1
Sequence length 236
Sequence
MFLESTIKERTPTFISETTHQCANREYISSLSVCDGISDCSDASDEVGCGKCVCNDASYR
CENGKCIPIMFYCNFKDDCGDGSDELLCVARNCSSEEWRCENGECIERNRRCNMIVDCLD
SSDEINCDQCSPDSFQCYDGKCITKAMFCDGQVDCSGNYREDEPTDCLKKCPPGYMKCRN
SYCIHISLVCNGKRDCVDNQDEDEAFCGNWTCPGFYRCKDSTVCLEMEQVCDGRQN
Download sequence
Identical sequences V4B6Y3
XP_009064927.1.39240 jgi|Lotgi1|132384|e_gw1.79.47.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]