SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|132447|e_gw1.79.255.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|132447|e_gw1.79.255.1
Domain Number 1 Region: 95-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000129
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 172-210
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000312
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 59-95
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000468
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 134-172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000109
Family EGF-type module 0.011
Further Details:      
 
Domain Number 5 Region: 210-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000133
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 6 Region: 327-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000222
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 7 Region: 16-57
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000244
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 252-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000262
Family EGF-type module 0.022
Further Details:      
 
Domain Number 9 Region: 290-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000401
Family EGF-type module 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|132447|e_gw1.79.255.1
Domain Number - Region: 379-401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|132447|e_gw1.79.255.1
Sequence length 402
Sequence
MCLYLLGFTSECLNSHFSPCSYLEPCQNNGVCQVSDGRSAKYKCECRPGWRGMNCTEQDL
CDNKPCRNNGQCLFLGHQLFKCECHDGFLGANCQHFNVCMTSPCKNGGICRMDQYGVFTC
DCPDNYSGENCEIFDACRPSPCRERGLCNKVGDRDFRCDCIIGYQGKRCDMVDKCLLEMP
CQNEGTCLKTGNNSYVCECPPATTGPNCEHFDPCSQFPCNNNATCTGIGKARYRCDCTQG
YYGEECQRYDPYLCRNNPCGANGECITVSDTFYICDCSYGYTGERCETRNYCSDETICKN
AGECVSVDDDFKCLCAENYYGRYCQFINYCKANPCINGTCQLKYQEDTIDDVDYLGGYIC
QCSDGFTGKNCELRIMGCRGRCLNGGSCDDSQCICPEGFIGK
Download sequence
Identical sequences V3ZTU1
jgi|Lotgi1|132447|e_gw1.79.255.1 XP_009064938.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]