SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|132702|e_gw1.80.162.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|132702|e_gw1.80.162.1
Domain Number 1 Region: 588-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 2 Region: 315-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000148
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 485-533
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 4 Region: 199-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000198
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 5 Region: 259-302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000276
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 6 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000279
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|132702|e_gw1.80.162.1
Domain Number - Region: 438-478
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000276
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 551-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 48-145
Classification Level Classification E-value
Superfamily Sialidases 0.0162
Family Sialidases (neuraminidases) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|132702|e_gw1.80.162.1
Sequence length 660
Sequence
MVDKGDSEPLDTSTWWQSITWPISLYEQTNNFEVSILMSFNKSFRMTGDMKIVFNSGRPT
DMILEKSSDYGVTWTPIQYYARNCKKYYDQGIAREITLDKADVVICTERYSGNVFNPQPG
LQVDFAAFSDRYILLFPNENYTVYYNSMGNSNLLKFFSFTDLKIRLLHPATDARETSRQQ
TDFLKYYYAISDISIEARCHCNLHSSSCTYVDGQATCQCKHFTTGVDCDECLPMYNNKPW
RPGTYSPYPTGTANQCEKCECYDHAVSCVYNETISQGVCVNCTHNTTGYSCENCLPGFFP
DGNVQLNDSARCIVCNCDTDGTVGRSNECAQSNGQCVCKPTTESRRCDTCKPGFYQFPRG
TPAQVHLNSYFIMSCQNTFNFIQICTCDPIGTVVNTVCYSIGGQCECKPGVGGLKCDRCL
SGFFNFTIEGCQHGCLPCECNQDGSTGEQCASSGQCPCKDTIGGRKCDICQTKYFQFSAD
GCITCNCSTTGSLTGACDIASGICECKDNVAGDKCDECKPQYFNLEDKNPRGCQPCFCFE
HGTSCSSATGYTAKQLTCEACSPNVTEPDCTTCKDGFYGLDQDGCKPCECDAIGSTSSVC
DKDAGQCTCNPHITGRQCNECEDNYHNLQSTGCTGKFLDFFRQNKNIFISFKIQIYMLDT
Download sequence
Identical sequences V3ZI72
XP_009065467.1.39240 jgi|Lotgi1|132702|e_gw1.80.162.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]