SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|132791|e_gw1.81.191.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|132791|e_gw1.81.191.1
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.96e-26
Family Nuclear receptor 0.00016
Further Details:      
 
Domain Number 2 Region: 68-220
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000000197
Family Nuclear receptor ligand-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|132791|e_gw1.81.191.1
Sequence length 230
Sequence
SCEVCGDKSYGKHYGVFCCDGCSCFFKRSIRKNINYTCIGKGTCIIDKARRNWCPYCRLK
KCLSINMNRNAVQEERGPRKNKGTRRNPYDKNRRTSTASDSPSSSSHHQSLESDHLPTSQ
IHRLSWNSYFTITICQQILMSSLRRLHYNRIFRSLYPADQMLLVQNTWSELFLLSAAYWP
VDICQIIHMASCKIKKILAGCQSLKVDNTELPYLETILVLRNGKKPSYLP
Download sequence
Identical sequences V3ZHN1
XP_009065505.1.39240 jgi|Lotgi1|132791|e_gw1.81.191.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]