SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|133010|e_gw1.82.184.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|133010|e_gw1.82.184.1
Domain Number 1 Region: 19-477
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.36e-101
Family L-arabinose binding protein-like 0.000000036
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|133010|e_gw1.82.184.1
Domain Number - Region: 499-553
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0377
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|133010|e_gw1.82.184.1
Sequence length 857
Sequence
MEYIGKYSNYAWPNRELSAVVPGNIVLGALHMIHERSEDKICGRIMPQGGIQALETMLYT
LDYINNQSNFLPGIKLGVLAKDDCDRDIYGLEQSVDFIKGSIANIGGSSYKCRDGSLPEN
DVKIIAGVLGAPSSVTSIQVANLLKLFAIPQISFFSTSPELSNTDRFPFFLRTIPSDINQ
AQAMVELVKLFRWTYVSVVYEESSYGMKGFSEVDKLLKEAGVCLAAAEILMKDSGVAVNE
EYDKVVHRLQRKGKAKGVIVFGSDQEVGEFMKAVKRMGATGDFTWIGSDGWGARGLAYRG
KESEVEGAITVQPLAVEVPGFKRYFMNLRPETNKRNPWFIEYWEHHFKCKYPGSLWTPLN
EEYNQSCTGKEQIDESNGFELEAQLQFVSDGVLAFANAAKRMHKDLCGGRYGLCPAMDPI
DGRTFKQYLLDVRFKSMAGTEFQFLPNGDGPSRYRILNFVQTSPGKYEWRTIGFFRDGNL
TIDTPPIFRYENPVHPSSECAKPCTATQAVIGNNSCCWQCRDCSKYQYLPTRNACMECPW
GSVASTNKKYCVSIPQRYLRYDDGISIGAMGLAALGIVITCWVAIVFYRHRETPVVKASG
RELSFVLLGGIFMCYSMTFVLVSKPLTMTCGAQKIGIGLCFSVCYAAILTKTNRISRIFE
AGRKTTKRPKFISPESQLVICGGLVACQIVISLIWLLISPPLAMAYYSNRDDHQLVCSAA
IGSGYMIGFSYPIFLIIICTIYAILTRKIPEAFNESKYIGFTMYTTCIIWLAFVAIYFST
ANSIMIRIATMCFSISLSATVALACMFTPKVHIIIFHPERNVRQSMMVPRPAFGKNNIPN
NCIRVDSGTQSDGKYGV
Download sequence
Identical sequences V3ZRW9
jgi|Lotgi1|133010|e_gw1.82.184.1 XP_009065660.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]