SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|133178|e_gw1.83.182.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|133178|e_gw1.83.182.1
Domain Number 1 Region: 3-124
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000014
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|133178|e_gw1.83.182.1
Sequence length 159
Sequence
TDINECDEKTFNCSDSTTCSNTLGSYQCQCQNGYEKKDGLCVDFDECATKSDDCEQSCEN
FDGTYNCGCEYGFELAGDRKSCLKDINECNDVNACEFICENKLGSFSCSCPIGKELENDG
RRCSGNSPEDGSLETSYTKCIDIRILSEYYQTTLIKMKI
Download sequence
Identical sequences V3ZRL9
XP_009065782.1.39240 jgi|Lotgi1|133178|e_gw1.83.182.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]