SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|134177|e_gw1.89.8.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|134177|e_gw1.89.8.1
Domain Number - Region: 322-367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 145-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family Laminin-type module 0.04
Further Details:      
 
Domain Number - Region: 282-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0159
Family Laminin-type module 0.077
Further Details:      
 
Domain Number - Region: 365-411
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0285
Family Laminin-type module 0.043
Further Details:      
 
Domain Number - Region: 62-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0469
Family Laminin-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|134177|e_gw1.89.8.1
Sequence length 491
Sequence
AFCSEMCDPFNYGPNCMYDCDCSSSGCNRLTGVCSCGPGLTGSKCEKSCPHGTWGDGCKK
TCSCDGQGGCDGVTGQCFCKPGFVGVSCDLKCSNGKYGQDCQQSCPCVMSQATGCDPVLG
TCKCKPGFQGNHCEKPCPVGLYGPSCNQICSCKNKAPCDPVSGQCICLAGFQGSQCEQAC
PESYYGDKCNTVCNCLRGDCSPSTGSCSCLPGWSGPTCNNKCTANHYGSGCSGVCQCQNG
GVCDFTDGSCACSSGFTGDKCDVKCPNNTYGVDCQTPCPYCAHSAGCDPIKGTCICTPGY
LGVQCDQPCSPGYYGDGCKTSCKCSTNGSCNNFDGSCVCSPGFMGPLCNQMCTSGTWGPG
CINKCDCPSHSTGCDRINGQCTCTPGFTGVKCIQSCVQGLWGQDCSNNCQCNSSTSYCSP
LDGSCSCHQGYTGSSCDQPCPPGRYGEGCKLTCICLNGATCDQTTGACVCADGFKGFNCS
QGKFLQYKLAP
Download sequence
Identical sequences V3ZFS5
XP_009066330.1.39240 jgi|Lotgi1|134177|e_gw1.89.8.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]