SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|135405|e_gw1.97.66.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|135405|e_gw1.97.66.1
Domain Number 1 Region: 726-861
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.00000000249
Family Pentapeptide repeats 0.0032
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|135405|e_gw1.97.66.1
Domain Number - Region: 12-91,210-308,492-650
Classification Level Classification E-value
Superfamily ARM repeat 0.0537
Family MIF4G domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|135405|e_gw1.97.66.1
Sequence length 862
Sequence
MKWEKICFSLLIHPSCKKISGELKKLFNNNEQFVLKVWCFLVKYFGEELHQGSFINSLLP
LVEMGFKTLEPDVKLMSFKAWKELINNFAMNPSKYAFAREKFETWIYYICKLGVKASVNF
DQVVVPLLQFCTGGNKLNTSTSFISTPTTPRFGVKNTPISIVSPTTPRLSITSTPSQLPT
FKTLQLKGVEILAQILGMSNYNYTTGELSNVTMPDIISSPMFFLKQSSVLISCLRELVMS
LGNEIPEDLLLATWSALVGHVNVAVDITPKSDHREMFSYFLSQFQFIALVENIAHLLLRM
FDSVCNIPLKVLSSNVYSVGMGHNIDVFFQGTPALFLCEILLSPILMQSLAQNERYMTIY
GKLVNCGFTITTGTLQFSQSVVDIIDRHSQYLPNIESLWRLWSVIANRLLEHIIKTSEIN
QGDSLEYDFTCLYTALILPIKHKIGSKVSQAVCKSVMKTWSDLYRCFSRQAALVTTAEDN
VVCEDFCSRIINSLSTEEFKPSLIDFIVQVLLVVLDCVNFSALSGATAFNLTGSFSPGKR
WMKHKQKPLENLHSFLHLFTDLLNNSIDIAEHTLSVTVAINGLVDIVTTMVTHTTNSNII
SNMFHKIAEPVSRLYSSSTNKNGTKLYTSAFYQKLEKLWLDISTCLQSRYTSIYDSDFLA
KISTLLEATFLHPRRPIKNQTILFWNTTFSKSSTLTYPDNLKKVLVKVKEKTPINLPGWV
NVETTIIDDTPVSQSQFSQVNIETTIIDDTPVSQSQFSQVNIETTIIDDTPVSQSQFSQV
NIETTIIDDTSVSQSQFSQVIIETTIIDDTPVSQSQFRQVNIETIIIDDTPVSQSQFSQV
NIETTIIDDTPVSQSQFSQVNI
Download sequence
Identical sequences V4B1I7
XP_009067258.1.39240 jgi|Lotgi1|135405|e_gw1.97.66.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]