SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|138086|e_gw1.121.64.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|138086|e_gw1.121.64.1
Domain Number 1 Region: 18-144
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.41e-23
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|138086|e_gw1.121.64.1
Sequence length 144
Sequence
MSTSSRRPSLPPMPDLNHLTEDERLVIENVLQRQKEEEEKEQDMIRQMKDEFENYQQSVL
KLNEETLKNLPEDIGAVCQVCHKTKFADGVGHSCHYCNTKSCARCGGRITIKGPTNKDQV
SVVWSCNLCRKKQEILAKTGAWYH
Download sequence
Identical sequences V4AYH8
jgi|Lotgi1|138086|e_gw1.121.64.1 XP_009046684.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]