SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|138790|e_gw1.130.29.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|138790|e_gw1.130.29.1
Domain Number 1 Region: 145-186
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000119
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 105-140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00088
Further Details:      
 
Domain Number 3 Region: 1-48
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 39-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 74-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|138790|e_gw1.130.29.1
Sequence length 218
Sequence
CLEKEFQCKSGECVSQSLVCNGKQDCHDSTDEHNCTVCRGFVCTSGLCLPSPFSKCDGKF
DCSDFSDEMNCGYKLCTNGVQIQSNKFCDKVDDCGDNSDEINCKCSGNRYTCPDGQCIMR
SWMCDGHPDCSDGSDEDNCSKYEIVITVRHICDTNQFQCTDYTCRNLTTVCDGSYDCPDG
SDEAKCGKSLSFKKPTNMSVRLDPHLSNLLRFLPILSS
Download sequence
Identical sequences V4CIE6
jgi|Lotgi1|138790|e_gw1.130.29.1 XP_009047420.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]