SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|139178|e_gw1.134.53.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|139178|e_gw1.134.53.1
Domain Number 1 Region: 49-553
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.41e-160
Family Myeloperoxidase-like 0.0000000000185
Further Details:      
 
Domain Number 2 Region: 3-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000152
Family EGF-type module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|139178|e_gw1.134.53.1
Sequence length 572
Sequence
AGNACCSYPCENNGICTTQGFDKFTCDCTGLDYYGDRCQHRKSTTWKKFVLLFKPSSDTI
HNLLVDNKWLWNIVNNISFLKNAAMKRIYLIRSFMVNSPAVYESEHEYPTFQAAVNYTYF
ARTLPPVPLNCPTPMGVKGKKELPDVDLVVDKFFKRTTFLPEPIGSNVLFTFFAQHFTHQ
FFKTDIKAGAAYQWGGHGVDVSHIYGKNKQVELALRSMKDGKMKMQVINGEEYPPYLKDV
DVPMTYPPGIPDTMKFALGQQVFGLLPGLFLYATIWLREHNRVCDILKQEHPEWDDEQLF
QTTKLIIVGETIKIVIEDYVQHLSNYHYKLSFNPELLHGESFQYQNRITVEFNHLYHWHP
LMPDDFNISGTVYPIKDFVFHSELVIKHGVKNFVQSFVKQRAGLMGHHNHCYMTLSVVRD
TLKHGRELRLQPLNRYRQRFGLPAFKSFQELTGETKLADELEKLYGDIDAVEFYVGLMLE
KRRYKAMFGSSIVEIGGPFSVKGLMSNPICSPKHWKPSTFGGEVGFNIIKTASLEKLFCL
NMEGECPRISFRVPDYVEGDVDDLIAKVRDEL
Download sequence
Identical sequences V4ACF6
jgi|Lotgi1|139178|e_gw1.134.53.1 XP_009047579.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]