SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|141314|e_gw1.159.35.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|141314|e_gw1.159.35.1
Domain Number 1 Region: 17-174
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.84e-33
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 192-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|141314|e_gw1.159.35.1
Sequence length 239
Sequence
MFVILTRSCLGFNLDGSPGSYAKFDHWEPCINGSLSFEFKTDRPNALLFYIDDGHSSFFE
LKLVAGIARLRLNLGDGTVILSAGQSLNDQQWHKVEIRRDGEQTTLTVDKIEHTRTLHGN
KFDTNNITDLYFFIGGLPNDYDQKLTSLALPSVVFEPKFRGSIRNLFYSSCAGPVERPTM
INHDGILSSDEDLCERGNPCLNGGMCLTTDDGLMCDCTRLEFEGDRCEIGELYFNFFIF
Download sequence
Identical sequences V4CDV7
jgi|Lotgi1|141314|e_gw1.159.35.1 XP_009049166.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]