SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|142042|e_gw1.173.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|142042|e_gw1.173.1.1
Domain Number 1 Region: 514-720
Classification Level Classification E-value
Superfamily L domain-like 2.92e-43
Family Ngr ectodomain-like 0.01
Further Details:      
 
Domain Number 2 Region: 729-1040
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.01e-40
Family Rhodopsin-like 0.00076
Further Details:      
 
Domain Number 3 Region: 130-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000576
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 4 Region: 343-379
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 383-418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 56-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000681
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 95-132
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000733
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number 8 Region: 307-338
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000942
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 9 Region: 202-245
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|142042|e_gw1.173.1.1
Domain Number - Region: 467-505
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000262
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 256-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00183
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number - Region: 173-206
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00288
Family LDL receptor-like module 0.0049
Further Details:      
 
Domain Number - Region: 18-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00353
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number - Region: 423-445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0157
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|142042|e_gw1.173.1.1
Sequence length 1092
Sequence
GIDLPEDAAEKQRICQLETSFECEPDVNGLDCVDKSLVCNGVSNCLNGRDESVEICGCLP
NEYQCNDTHCIDLIKRCDTFNDCEDGNDEESCETFVCPDNFYKCDNHFCIPRELECNFVD
NCGDNSDEIRCARRQCLSTEFRCDNKECIPMAYICDTMLDCIDGSDEHAQICDEHFRCPF
GFYVNKTLVCDQWPDCPFTHQDQTNCKSFQCRVDHFKCHNNQCIRKTNKCDGVCDCTQCE
DEDYCKIAGEVCTIGEKYMCKSTRYPRCINKRYVCDGNNDCLDSNTGGDEDLCGDISNGC
SKSEFDDPVLCPEGRCLPGNVRCDYYADCVNGEDEQNCGESKKACKEGEYRCLNQQCIPR
YKRCDGKTDCFDRSDEAHCDKEECLPGYNRCNSGQCIQISFWCDHWRDCPDNSDELACGK
YENCRPDEFQCTNGQCIPQDNLCYGGKKKGRTICSDNSHLLNCSQYVCSEATEFKCRNSY
CIDKEQKCDGNLDCKMTFWDEYFCEYACPYRNEKCICMDKEMNCEHQNFTELPSFIDNTL
TKFRLSWNNLNASISADTFHEFTRLTYLDLSHNNLHFLPENSFKSLWRLSTLNLANNVLT
EIRNETFLGLGNLRQLFLSGNKIRYIHPDSFVGLSHLRTLDLSNQDINIIPQNAFNGLRN
VYNLNLSNNHIEYVSDGAFNGLTKLYLLDLSHNAINLIEENVFHGIPNLRTLHTDEYRFC
CLATDVDQCYPEPNEFSSCEDLMSNYILRISIWILGMVAGFGNLLVIGWRARDLRGGKVH
SFLITNLAIGDFFMGIYLLIVAVVDSYYRGVYIVHDKAWRNSDLCRFAGFLSTLSSELSV
FTLTVITLDRLICIIFPLKMRRLSLKESFLVMLGVWLVVLCLSVLPLIGLDYFTNFYGRS
GVCLAFHITPDHPPGWEYSVAIFLVVNFISFLLIFLSYFWMFTVAKRTRSAVRATETKTD
AAMARRMTMIVMTDFFCWVPIILLGYASLGGASIPQNVYAWVAVFVLPLNSAINPVLYTI
STAPFLGNVRHRAYRFRKSFMNSFTQETKHTFMEERTSNTGYDRKQYRHMDLIKMRTMDR
SPVHSHSEQSEF
Download sequence
Identical sequences V4CBE4
jgi|Lotgi1|142042|e_gw1.173.1.1 XP_009050139.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]