SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|142208|e_gw1.176.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|142208|e_gw1.176.1.1
Domain Number 1 Region: 480-493,528-893
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.79e-97
Family Formin homology 2 domain (FH2 domain) 0.0000000627
Further Details:      
 
Domain Number 2 Region: 48-381
Classification Level Classification E-value
Superfamily ARM repeat 1.38e-80
Family Diap1 N-terninal region-like 0.000000191
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|142208|e_gw1.176.1.1
Domain Number - Region: 358-423
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|142208|e_gw1.176.1.1
Sequence length 961
Sequence
MNLTEEKKAPLRKRDITLKRSMLAMHYKGASKLKFVFFLFFQPKGDTDTPQDFINELSNA
DLKGEKRLRVLESLRVSLTSNPVSWIQDFGEKGFNGILRNLTYCCDSKSDRRSTYECVRC
LKAYMNNKYGLLQILNHEEALIILSRTIDPSDPATMLEAVRLLAAICLVPPNGQEKALEG
ITVCGEIRSQDRFIPIIMGLGMRDNIAMQVACMQLVNAIVSTPEDLDFRLHLRNEFMRTG
LNQLLPTLDQFDDNELKTHVDIFNAHKEEDHEEFSHRYDNIRLELEYPFYFNNHWLWHVV
GTIGNTIAEPYFLSILQHLLSIRDDIYSRPQYYKLIEECVTQIVLHRSGVDPDFRATQRF
EIDVEPLLSNLTEKSKFEDSESAIDNAKFHEALTAKQEAEAKAAGFEEKIKALEQENQQL
KQKVSGPPPPPPPPGPGGGPPPPPPPPFPGGGGPPPPPPPPFPGGGVPPPPPFPGGPPAP
PPPPGMGGPPPPPGFMSPPGAPSPPTNVLPFGMTMKKKYSTNTQTKRLNWNKVNVRNLDK
ESLWVKIDETELESDDLLKGLEEQFAVKAPPKKETDGEETKKPARKVKELKVLDGKMGQN
LSIFLGSIKVPYAEMKRRILAMDEESLSATVVEQLIKFMPTPEEMNKIAGLQDDYKDLAE
AEQFCVTMSKIKRITPRLNSMLFKMRFPELVADIKPDLVAGTEACDQVIKSKKFAKLMEL
ILLVGNYLNAGSRNAQTVGFDVSFLTKLGNTKSQDGKTTLMHFLAEMVDKKYPDIAGFID
ELTYTDKAARVSDEQINKNLKGMETQLKQLETDLKIAQKQPAFISSAQDQYDVLNNMYKK
LDSLFTDLSKYLTFDNKKYSLEDFFGDLKAFKDGFLNAQKENTKIQETQEKIRRAKEIRE
KAEREKKDKKARQKALLDMTTDDDQEGVMDNLLEALKTGSAFSVNREKRDKRTKTPRAAG
G
Download sequence
Identical sequences V4AVL2
jgi|Lotgi1|142208|e_gw1.176.1.1 XP_009050211.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]