SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|143391|e_gw1.201.9.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|143391|e_gw1.201.9.1
Domain Number 1 Region: 126-376
Classification Level Classification E-value
Superfamily vWA-like 6.23e-52
Family Integrin A (or I) domain 0.00000436
Further Details:      
 
Domain Number 2 Region: 384-460
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-17
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 638-718
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000126
Family Integrin beta tail domain 0.0014
Further Details:      
 
Domain Number 4 Region: 24-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000288
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 550-590
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000036
Family Integrin beta EGF-like domains 0.0036
Further Details:      
 
Domain Number 6 Region: 594-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000389
Family Integrin beta EGF-like domains 0.0034
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|143391|e_gw1.201.9.1
Domain Number - Region: 515-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family Integrin beta EGF-like domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|143391|e_gw1.201.9.1
Sequence length 795
Sequence
MIYYHCHIFILCVFLYFLVARLSSNPCANVKTCGECIQTASVCAWCPDETFPKHESRCEP
YDHFVATGSCPTDKIVYPQYKLDLLQNEGVQGGDKGQDPIQVQPQKIKLNVRPNQEVKLK
LKFRQAENYPVDLYFLLDMSYSMIREKDAQTRLVSLADEMGASMSKITKNFRLGFGNFVD
KAAMPFIPWTDEMLQNRCQVKSGCRYPFDFQNQQKLTENQEIFKNNMKKALEVMSQSLDD
PEGGMDGIMQVLSCEDAIGWRDRSRRILVYSSNSLFHLAGDGILGGAVMANDGMCHLNGS
GILVGWDTKMDYPSVSQIASKVRDTSTNVIFAVMENVYDLHRQLARRLEGASIGKLLEGS
ANIIGLVQKSYDKLRSRIEFIPKNAENITIDFKSKCKGAVLSTTNKCEGLEIGDEVEFDV
SLKVNHCGGKRQRSVNIGAVGLSEQLTVDLNLICECDCEKPGQEEKNSPKCFSGNGTFEC
GQCTCNKGRYGRQCECDETELSSTQSLKNCKSNVNSSIVCSNHGECVCGECECYPIRVNS
ARTYSGRFCECNDYNCYYYDGQMCGGTNRGVCKCGKCQCLPGYTGDDCGCSSRNDTCIAS
NGEICNGKGTCDCGRCTCFKEGNYRGPTCEDCPECPTKCTVHRGCAMCKAFKDGAYNSTY
CADACKDVRVVQNLAGKDPSITHCTFRQADTECIRKYTYEYDDINVIIKVQQNEECPEEF
PVLPVALGIVGAILLAGIIAILIFLCWKRRQEAKEFAQFKKDQERARWQSDENPIYRDPT
TTTKNPTYSGGKKNE
Download sequence
Identical sequences V4A078
XP_009052118.1.39240 jgi|Lotgi1|143391|e_gw1.201.9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]