SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|143631|e_gw1.211.35.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|143631|e_gw1.211.35.1
Domain Number 1 Region: 48-90
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000576
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 2 Region: 3-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000942
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|143631|e_gw1.211.35.1
Sequence length 110
Sequence
DKACSSDTFRCKEAISPGSYCIPKNWECDSDADCPGGEDEHEDCSIPTCPSNQFQCKLGA
ARCVPNGWLCDGEHDCDDGSDELHETCMYSNIFNFILHIQFIDCQVLKRL
Download sequence
Identical sequences V4AIF8
jgi|Lotgi1|143631|e_gw1.211.35.1 XP_009052542.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]