SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|143701|e_gw1.213.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|143701|e_gw1.213.1.1
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.43e-38
Family Motor proteins 0.0000127
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|143701|e_gw1.213.1.1
Domain Number - Region: 354-440
Classification Level Classification E-value
Superfamily Prefoldin 0.00118
Family Prefoldin 0.013
Further Details:      
 
Domain Number - Region: 199-304
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0157
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|143701|e_gw1.213.1.1
Sequence length 723
Sequence
VSKTGAEGAVLDEAKNINRSLSALGNVISALADGNKSHVPYRDSKLTRILQESLGGNART
TMIICCSPASYNESETKSTLLFGQRAKTIKNVVSVNEELTADEWKKKYEREKERNAKLRA
IILKLQEELAQWRSGVTVSPDDQIDVKTASTVELDTPSNSAPPSLQASLIATNLTDDERK
QLEEEKIKLYQQLDDKDEEINNQAQLIEKLKEQMLEQEELISQSRKDYEGVTQEMSRIQA
DNESAKDEVKEVLQALEELAMNYDQKSTEVENKNRDIEQLTEELSTKLTTLNSVQSEFET
LRDSSLHQKKRSSDMMLSLLKDLSEIGTIIGGSAAESKVCGKIEEEFTVARLYISKMKSE
VKSLASRCQELENSQSECNKKFEDTKNELSDCKLKLVQHEAKITTLNDTIKDIEGKKRQL
EENVDSLNEEIAKLRAQEQMHATAVSKQAEASSKLRSETELKEALESQMEMHRENHQKQL
SALREEISEKQSIIDTLKDTNQKLTLALEKLQSDYDQLKQEEADKSTKLSELSVQMDRRE
QAKQDLKGLEETVAKELQTLHNLRKIFVQDLQNRVKKKEDEEEEDAVGSTAQKQKISFLE
NNLEQLTKVHKQLVRDNADLRCELPKLEKRLRATMERVKSLETALREAKEGAMRDRKRYQ
MEVDRIKEAVRQRNLARRGHAAQIAKPIRPGQHPSNSPAQSTGIRGGGGSQNGPNPIKIE
GKA
Download sequence
Identical sequences V4C562
jgi|Lotgi1|143701|e_gw1.213.1.1 XP_009052589.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]