SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|144813|e_gw1.265.12.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|144813|e_gw1.265.12.1
Domain Number 1 Region: 2860-3035
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-36
Family Laminin G-like module 0.00078
Further Details:      
 
Domain Number 2 Region: 3266-3461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-34
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 3467-3625
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.68e-32
Family Laminin G-like module 0.0000953
Further Details:      
 
Domain Number 4 Region: 2671-2839
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.16e-30
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 3029-3216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-26
Family Laminin G-like module 0.009
Further Details:      
 
Domain Number 6 Region: 1906-1960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 7 Region: 1380-1428
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 8 Region: 1470-1520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 547-595
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 10 Region: 638-686
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 11 Region: 1800-1842
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000949
Family Laminin-type module 0.0049
Further Details:      
 
Domain Number 12 Region: 743-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.0057
Further Details:      
 
Domain Number 13 Region: 501-549
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 14 Region: 1855-1908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 15 Region: 280-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000363
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 16 Region: 454-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000067
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 17 Region: 1518-1566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 18 Region: 796-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 19 Region: 409-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000187
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 20 Region: 2006-2055
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 21 Region: 593-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000053
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 22 Region: 1432-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 23 Region: 339-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.049
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|144813|e_gw1.265.12.1
Domain Number - Region: 1959-2003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000123
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 1760-1802
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000204
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 709-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00026
Family Laminin-type module 0.014
Further Details:      
 
Domain Number - Region: 2053-2100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 124-239
Classification Level Classification E-value
Superfamily Sialidases 0.0562
Family Sialidases (neuraminidases) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|144813|e_gw1.265.12.1
Sequence length 3645
Sequence
MARQGYFPIFAFLCYISFYTNLNAQVLTPPYFNLAQTRNIEASATCGEDVAGPELFCRLT
GATSDHLRNDEKDRELIRGQLCDHCNTEILQTEAVTNKNSYKQDNSVNQKSCPKNGKIRH
KSCIVVDFFKEFHVAYVFIKMANSPRPGVWALLRSTDFGDSWKPWQYFADTPSDCMEFFK
TPADQRIQYDDQVLCTTEFSKVVPLENGEIVISLVNERPNAKNFSYAYNLQNWTKATNIR
LQFIRTKTLLGHLIGVAREDPTVTRRYYYSIKDISIGGRCVCNGHAETCDTPDVDDETKL
LCTCQHNTCGDQCDTCCPGFLQKAWRRALVDQPFTCEPCECYGHTTECIYNETVANEGKS
IDIHGNYDGGGVCQNCQHNTMGINCEKCVPTFYRPYGVPRNATDACRRCQCDLRISTGEC
EEGSGRCLCRIEFAGENCDRCNVGYYDYPNCKPCDCNINGTDGDVCTVAVGGQCPCLPNY
VGRKCDMCAFGSWDFPECRPCECNPIGTPSTTCNVEDGQCQCSSNFGGRVCDRCADGFFG
HPSCEYCDCDTYGTEPGVCDKVNGNCLCKANYSGERCDRCTSGYYGFPNCQACQCAEPGS
RSPICQVNGQCSCDRNYGGLNCDRCAPGYYRYPDCIPCNCDRFGSLGLSCNQTTGQCKCR
QNFMGTACDKCVEGFYNYPMCEECNCNPAGAKQIPGYPLGGCGEVIKGQLCECKERVQGR
ICDECKQGYYSLNRNNPLGCEECQCHLPGTVSGDNICDVKTGQCVCKPDVSGQNCQECRD
GTFNLQENNPFGCVDCKCDPGGSSSLICNKLTGRCICKPRVTGEKCDQPIQTHFYPDLHQ
YKYEIEDGVTPEGQTIRYGYDERIFPSYSWRGYGILTSIQPEVLLDVEITKPSLYRMLYR
FVNRNDQTVTATVTLKPESPQQITQSSQVLFKPTETPDFVNVGNGGAQSTFVLNPGRWSI
STTSPDILFLDYFVLIPQSYYEATVIQDKVIRPCAIPANGEACLHYSYPDLEGYPTIHGD
QGYNVVDQQRKSIEGYPDQQVLDELGVSNLGHLNPNQTFFFLDLNVPFPGDYVLVLNYYN
PEDRRQDLDVDIASADGRAKAMVNLYKCQYSTVCRQVFKDVDGMIGIFNITSGYASITLR
GPPNINIGIESVTAIPFEDWNPGFIQPRIICIRVNGVCVPSTYTNPGGAIRIDFEQAPNE
DRLATDYPTGIIDPNIGLVKLNMSEPSIEIEGEVGTRRQFVFLIQYYQPNKVGMTVPITV
YVNNQPMHGKFNAKYCPSVTGCRGTVIFDETSSEILTLKDKNVRLLVNNTEDGDLWLDYV
LFVPASNYKLTDLDLQPIDKSANFLQACVNEGFELNLDNAECRDGAFTLTTEFNNGALAC
DCNIDGSLSFNCDSFGGQCECRPNVIGRKCRACQPGYYGFPRCKPCNCPFGLCHPVSGEC
TCPPRVTGERCDTCKPETYGYDALIGCQECGCNQQGVVNEDLNCDDNTGQCQCSPNIGGR
KCDTCHNGYYRFPICRECDCDRSGTKSDICDQRTSQCFCKDNVAGDRCDVCADDTYFLDV
NNPVGCTKCFCFGTTTRCDSSGLFWEEINDMKGWGISNTVGTQVREAGQTIALVDISDKI
VDSADAMYWIAPSTYLGNRLTSYGGKLKYNILFTLPRDNPEQSLGLIKPDIILVGNNMTI
VHNSESQPTANIQTDMELALIEHSFRHEIGGDMVTREQFMMILVNLQALHIRASYYTIID
EGRLTDVMLQVASSIGQGDRASNVEQCQCPPNYQGTSCEDCAPGHYRSLNSPYLGICVPC
NCNGHAESCDQVTGECLNCQDNTYGTHCEFCLEGHYGNPATGRCTICSCPLPIESNNFAT
SCYISDETGFTSNCQCREGYYGDNCERCAPGYFGDPRTEGGYCRPCDCSGNLDMSDWGAC
DQTTGQCLNCQNNTGGAQCEICREWYYGDAINSKDCDRCSCDYCGSEKCNDQNGVCECKP
NVVGLNCDKCAPYSYGFEECTGCRQCECGQASESPQCDVLTGQCTCRDHVLGRKCDQCQN
GYWNYGSTGCERCPCMEAGSALSCDAVSGRCECLSGVTGDLCDRCLDRWVLIPGVGCQEC
DNCVHILIDDLDHFDRNVSVVRRQLASVSVGVGAFMKISQINDTVSLLKVNLMLILIQSI
SNAEAVDEDTRLLREEAFNQIQHAQEASIAAEGMLKEIVKRFSKCFMCIRSTVSINLCHS
NLSEVIDEILRRMLGRIQVSYVDSYITDAEDTLTRIEAREFEAQNQTCVAENSESERAEE
IEMSVMKQFGRIMNVSSDLADVKTRLYDLQNSSQFSQTGSRQTIDILRELRDINLDGLEN
GIEGILTGKDNSINLLDMARDLLDKSRKEMDDSQEVFLTIDRESSRLKSAVTALEVFVDN
LDRGLDGMESLIGNATQHANELAEQSEQLDSMYTNTRDTAAESVNAAEAYTDIVDAINDA
ENASMVALESAKAALEKSGGVGDTTAKSRERSETLLSSADDAYSQTQSELSDRLAVASEQ
TDELMELNDKTSADLNEVHEIMDDLPDQENERSRSAIVIAEDSLSKAMEAENKISSIVDQ
LPEDERKAKQIPNDAFTRDRDIRKTQNQLNTIRSLTPDIKNLVGSLGQRSAGLAEIGKSV
LANVTQLKERIALARDEANRIRVGLQYLANTTLTLRNPPNIEQAGSHSKVSFYFRTKNLN
GFLLYLGGDQKSGRPEPDDYIALELLNGQVVFKYNLGSGAARIVSPQRVDDGMWHQVVAE
RIGKTGYLTIRTDKQDDTKVSGTSQGTYTVLELNPLTTVMYVGGAPDDAMLPENLLRTPY
DGVIEELVFDEQPIGLWNFKDGENNYMGANERDVFKAITSNGLRFNGRGYVILSRKELRF
VPAKSVDVLMKFKTYAENGLLVYMTDNKRDFLSVEIRDGQVYFQYDLGYGRATLVSGERY
NDGSWHSIQASRVEKDGLLLVDGTEVAKGQSKGTLKELSIIDDIFIGGYNQPTLNTKDVM
TDGFEGCIKDLQFGSSLWDLNNNRAAKGVVIGCPEQVARVVSFSALKPGFVAVSAESIGE
KFDLTFKMKTFQNDSLVLFASGASNSIFSVSISEGKLVVISDPGNQRTQLESKYNKYGDG
NWHYISIMKDGLKLTINIDDYETVETVADGRISNLLTTSPLYFGDIPSDYDTRDLDLPST
TRTVGCIGDVTVNMQSVNFASIKESDRRGVNLAGCPASFDGGRVPVTAGPDTKTDWITKL
YFLQASTNQRSLSCSHNEKTTQPPLQCALPVIPDENLSTDVSGTRFGAKNDSRVEFEKLP
ARFRIKSEFSLEFKTEADNGLLFYASDPKHVDFLSLSMIQGQVVYGFNCGSGAADIRSPQ
KYNDGKWHMATFARAQRTGRLFIDGTEVGQGKSTGGTRSINVKPPYYVGGIPHIKEMKKA
VRNLKVSNVFFAVSSFVGCIRNPTLNNKDFGTPSQEYQTSPCSDAMESGTFFPADAYMLL
FDNFKVGLDKEIYLEIKPRVTSGVILAVHSKGGDFFAIQLVNGKLIFNTDNGAGMIQTEY
TPTAQNALCDGNWHTIKATKAKNVASLEVDGVQMKQGIGKAGSSEANTNDPIYVGGVPTD
GIRKGLFTEENYVGCIRNMWIDGKVEFIGNGKPMGDVQILSCPRS
Download sequence
Identical sequences V4AMT0
XP_009054407.1.39240 jgi|Lotgi1|144813|e_gw1.265.12.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]