SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|146735|e_gw1.1052.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|146735|e_gw1.1052.1.1
Domain Number 1 Region: 193-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000286
Family EGF-type module 0.013
Further Details:      
 
Domain Number 2 Region: 153-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000536
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 3 Region: 76-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000652
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 4 Region: 1-37
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000875
Family EGF-type module 0.012
Further Details:      
 
Domain Number 5 Region: 36-76
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000002
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 111-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000612
Family EGF-type module 0.014
Further Details:      
 
Domain Number 7 Region: 232-274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.014
Further Details:      
 
Domain Number 8 Region: 274-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000216
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|146735|e_gw1.1052.1.1
Sequence length 313
Sequence
CDSHPCHNGGTCLPTTRGRFRCDCPRGFKGKTCDKEINPCDSHPCHNGGTCCPTTGGKFS
CDCPRGFKGKTCDIVINPCDSNPCHNGGTCYPTTGGKFRCDCPRGFKGKTCDIEINPCDS
HPCHNGGTCCPTTGGKFSCDCPRGFKGKTCDIAINPCDSHPCHNGGTCLPTTRGRFRCDC
PRGFKGKTCDKVINPCDRHPCHNGGTCYPTARGKFRCDCPRGFKGKTCDIELNPCDSHPC
HNGGTCCPTTGTTRGKFSCDCPRGFKGKTCDIAINPCDSHPCHNGGTCCPTTGGMFSCDC
PIGFKGKTCDIGW
Download sequence
Identical sequences V4BES8
jgi|Lotgi1|146735|e_gw1.1052.1.1 XP_009044981.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]