SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|148105|e_gw1.6054.1.1 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|148105|e_gw1.6054.1.1
Domain Number - Region: 1-80
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000824
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number - Region: 131-241
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00569
Family Growth factor receptor domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|148105|e_gw1.6054.1.1
Sequence length 279
Sequence
CKSGYHGNKCDTPCPTNCKGGCIQNSGNCNNCKSGYHGNKCDTPCPTNCNGGCIQNNGDC
EACNDGYWGIKCEKQCPTNCRLSKCDKNNGYCSECKNYYWGDKCEERCSVNCIDHLSITC
YKTSGKCNSGCKDTWYGDTCNNKCSSKCKQSKCYQSQSRPVTCTTGCIDGYKGNYCQDTC
LDNCISCNNNQCTSCNTGWYGNQCQTKCNSNCINRCDQATGDCLDGCIDGKTGRQRTLCL
KIRAPAPCTPQPKSDMDRMKRHLFANLKIKVSTVLMNKI
Download sequence
Identical sequences V3ZRD1
XP_009062425.1.39240 jgi|Lotgi1|148105|e_gw1.6054.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]