SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|151283|fgenesh2_kg.C_sca_105000003 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|151283|fgenesh2_kg.C_sca_105000003
Domain Number 1 Region: 17-140
Classification Level Classification E-value
Superfamily Prefoldin 1.52e-17
Family Prefoldin 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|151283|fgenesh2_kg.C_sca_105000003
Sequence length 153
Sequence
MDEKTSKVIQYETFLNNTLREDLKKILEARDKIHKETSDYLQLKIVIERLQESQLLEDEL
KTKIDLGNSFFVQAKVTDASKICVAIGYGFFVEFTFEEALKFIQKKTTRLSEHANVLTQD
ASRIKAKIKLVMEGLREMQGLPAKSVKPFRDIL
Download sequence
Identical sequences V4AJM1
jgi|Lotgi1|151283|fgenesh2_kg.C_sca_105000003 XP_009044962.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]