SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|152053|fgenesh2_pg.C_sca_1000191 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|152053|fgenesh2_pg.C_sca_1000191
Domain Number 1 Region: 937-1070
Classification Level Classification E-value
Superfamily CBD9-like 0.000000000000981
Family Cytochrome domain of cellobiose dehydrogenase 0.0029
Further Details:      
 
Domain Number 2 Region: 1101-1186
Classification Level Classification E-value
Superfamily SEA domain 0.000000196
Family SEA domain 0.012
Further Details:      
 
Domain Number 3 Region: 447-571
Classification Level Classification E-value
Superfamily CBD9-like 0.0000667
Family Cytochrome domain of cellobiose dehydrogenase 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|152053|fgenesh2_pg.C_sca_1000191
Domain Number - Region: 183-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000778
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 155-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00754
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|152053|fgenesh2_pg.C_sca_1000191
Sequence length 1319
Sequence
MWIILSLVFSCLPCITGHISLIYPPSRKYDFDFMDNLLTPGPCGVPTGLGPSTTLLAGST
INVKFHLAYPHKGGFFLEVMNNNTNAILRHPQSGVLSSSNTTLRSAELTLPNQECRGCWI
RLVRQAAEWVASCRKGYVFWSCADVDIIQTGFIESCSGHGTWRNNKCECGMLWIGDRCEH
KVDCKDASDCNDHGECVDIATDPNPIKHCYCQHGWHGIQCDKTSSVATKNIDYSLYKKSE
LSPDYMLFYRYIAISEEIEMVLKVNSSNWVAIGWRPQSFRSGCQLFPNLPNARAWSAGED
EVNTKETTPKPEGEAEATTEPESVPETPKPEGEVTSEPETEGEVTSEPETEGEVTSEPET
EGQVTSEPEPETEGEVTSEPETEGEVTSEPETEGEVTSEPETEGQVTSEPEPETEAEVTT
EPESEPERACGSEWSTGCTNAGCTYKASWTYDSSNDEINFVLESTSTTSWLAIGFSDDQL
MPGSDAFYGFYENNQLIVKDAYLAAKQTPTIDGTQNVVVVNGAVTNGILKIEVKRARNTG
DSADKSFTDSDCYYFLYAMGTVNSGSISYHSKRWISTEKICIKACAIDQSYLSLTIKSVG
AYVVTTPKPEGEAEATTEPESVPETPEPEVTSEPETEGEVTSEPETEGEVTSEPETEGEV
TSEPETEGEVTSEPETEGEVTSEPETEGEVTSEPETESEVTSEPETEVEVTSEPETEGEV
TSEPETEGEVTSEPETESEVTYEPETEGEVTSEPESEGGTKTCQSPLPELGYSSGGRIVG
TNDRNGNAPRYGMDCSDIIVGTARGETSRIGDYYSRDRSTPKHDSVYGGEDSLTAALGFE
NDGQTVIVFRRKVQAFHRSDHTIEKGIMSVIWAHGQIEDSYRHNPESGDKPGFYAKDQLL
YHGASPNRGTASINFLESARDLSTSCNGNWPTECDNCDLEVSWVYNEDTDDISFTMKARL
NEESKWIGVGFSKDKNMANSDAIIGWVDNGQVHVSDRWMTGQVQPQKDAKDDIKNKRGIV
ENGVTTITFDRARDTGDSSDLAFTDNQCLYMFYAVGGGYKSSDESITKHGNTPTVSSSKI
CIRSCDVVASGTSLISTVEVTFNNQYDSKLSDRASDEFKNLERTMKEWMDMVFKSLPGYL
ETKILQFKQGSIIVVADVESIRDSDSVSNKAQYKTDIESLLQRGQSSPPQGYTITGFNVG
NPRSVQAPKPFRLTLIEEIVIGLTVSLVIVIVIVAVCKLSETQREKKKAAASNKHQRFNG
DSSSGSSTTSLSNQKPTLDYKMPAQGYTNAGYNTTLNSSNGTQRSTITYDEFIKTKNIP
Download sequence
Identical sequences V4BC59
jgi|Lotgi1|152053|fgenesh2_pg.C_sca_1000191 XP_009043781.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]