SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|152123|fgenesh2_pg.C_sca_1000261 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Lotgi1|152123|fgenesh2_pg.C_sca_1000261
Domain Number 1 Region: 460-612
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.58e-39
Family Toll/Interleukin receptor TIR domain 0.0000794
Further Details:      
 
Weak hits

Sequence:  jgi|Lotgi1|152123|fgenesh2_pg.C_sca_1000261
Domain Number - Region: 260-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000689
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 72-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00229
Family Integrin beta EGF-like domains 0.08
Further Details:      
 
Domain Number - Region: 40-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00503
Family EGF-type module 0.079
Further Details:      
 
Domain Number - Region: 326-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00572
Family EGF-type module 0.023
Further Details:      
 
Domain Number - Region: 232-258
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family Integrin beta EGF-like domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|152123|fgenesh2_pg.C_sca_1000261
Sequence length 676
Sequence
MFTYILCVISHGFIGILAQTTEPVTTLRPIDERICVPGFVCRHGHCVKSDFLECICDPGW
IGTFCEKHCPVDCGQHGKCMMYNEKPTCVCDWRYTGSFCDKIKFPTTTVVSESTTQITNI
TSLSTSLPQNLSTTMQPLNMPTTNALSTTDQGQQSLGSYPSTSTTQILLRSSTSTSPITL
VPESSITVSLPSTTNPITTSTSSTLPPATTSLSSPAASTNSPQRTECFPGFICQHGQCPE
GRLICICDEGWVGPFCEWKCNLTCGDNGHCNSYSDGGVFCNCKPGYTGDHCDIFETTIPE
TTTIPTTISSTNHTLPPKSQENELSNLKQCKPGFTCLNGICNKIDTKPSCICEFGYMGLF
CEKKCPITCDMNEICELHSNGSAFCSCNWTHTGLNCTKLRPDPDEFRGDQNDPVWYWYLI
GSCIVLLVILLILVVVIPYCMWKRREIFIMKIMYMFQPYEDDDDKMFDAFISYKSTAKDE
DFVLRQLFPRLETENNFKLCLHFRDFIPGENISNNIIWAVENSRRTILILTPDYIQSEFC
RFEYQRAQHEMLNRKQRIIPIILEDVSNQMNYMDNALRSIVKSITYLTWPGEKKEADVNK
FWKRLELSLPKKRQERNLCKTKGKSKPENVKLRRFSRDIRPSNTDDNDFVRLSIDDESIL
NEFRNSRDTNSMTVLM
Download sequence
Identical sequences V4BH64
XP_009043837.1.39240 jgi|Lotgi1|152123|fgenesh2_pg.C_sca_1000261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]