SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Lotgi1|152268|fgenesh2_pg.C_sca_1000406 from Lottia gigantea

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Lotgi1|152268|fgenesh2_pg.C_sca_1000406
Domain Number - Region: 50-89
Classification Level Classification E-value
Superfamily Prefoldin 0.0471
Family Prefoldin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Lotgi1|152268|fgenesh2_pg.C_sca_1000406
Sequence length 132
Sequence
MPTEQKALADSLKSTVRKRANLRSLFTREDKRVCSIIESQDMDGVQLLKVIQNKLVKSKE
QLHRLDEEIQDLHMQMDRSDLADQDFEECDILYDNHGLIMNKIADFLSKVSSKTSTPTIF
GTDVFHFKRKTL
Download sequence
Identical sequences V4BHS7
XP_009043962.1.39240 jgi|Lotgi1|152268|fgenesh2_pg.C_sca_1000406

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]